2MKR: PDB entry 2MKR

Structural Characterization of a Complex Between the Acidic Transactivation Domain of EBNA2 and the Tfb1/p62 subunit of TFIIH. Determined by solution NMR. Released 5 Mar 2014.

Method: Solution NMR
Organisms: Saccharomyces cerevisiae S288c, Human herpesvirus 4
Chains: 2
Atoms: 1,017
Mol. weight: 14.54 kDa
Released: 5 Mar 2014

Explore 2MKR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MKR contains 2 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	1
β-strand	12-19	8	1
β-strand	26-31	6	1
β-strand	37-40	4	1
β-strand	45-50	6	1
β-strand	59-64	6	1
β-strand	86-90	5	1
α-helix	94-114	21

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	455-463	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA polymerase II transcription factor B subunit 1	A	protein	115	Saccharomyces cerevisiae S288c	P32776 (AlphaFold model)
Epstein-Barr nuclear antigen 2	B	protein	13	Human herpesvirus 4	P12978 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MKR_1 RNA polymerase II transcription factor B subunit 1 (chains A)
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMML
RLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD

Sequence of entity 2 (B), FASTA

>2MKR_2 Epstein-Barr nuclear antigen 2 (chains B)
DLDESWDYIFETT

Primary citation

Structural and Functional Characterization of a Complex between the Acidic Transactivation Domain of EBNA2 and the Tfb1/p62 Subunit of TFIIH. Chabot, P.R., Raiola, L., Lussier-Price, M. et al. PLoS Pathog (2014) 10:e1004042-e1004042. DOI 10.1371/journal.ppat.1004042 · PubMed

Other PDB entries of the same protein (UniProt P32776 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7O4J 2.9 Å, Yeast RNA polymerase II transcription pre-initiation complex (consensus)
7ML0 3.0 Å, RNA polymerase II pre-initiation complex (PIC1)
8CEN 3.0 Å, Yeast RNA polymerase II transcription pre-initiation complex with core Mediator
7ML4 3.1 Å, RNA polymerase II initially transcribing complex (ITC)
7ZS9 3.1 Å, Yeast RNA polymerase II transcription pre-initiation complex with the +1 nucleosome…
7O4I 3.2 Å, Yeast RNA polymerase II transcription pre-initiation complex with initial transcription…
7O75 3.2 Å, Yeast RNA polymerase II transcription pre-initiation complex with open promoter DNA
7ML2 3.4 Å, RNA polymerase II pre-initiation complex (PIC3)
7O4L 3.4 Å, Yeast TFIIH in the expanded state within the pre-initiation complex
7O72 3.4 Å, Yeast RNA polymerase II transcription pre-initiation complex with closed promoter DNA
7O73 3.4 Å, Yeast RNA polymerase II transcription pre-initiation complex with closed distorted…
7O4K 3.6 Å, Yeast TFIIH in the contracted state within the pre-initiation complex

Browse structure collections

About this viewer

MolViewer shows 2MKR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.