2MKV: PDB entry 2MKV

Structure of the NA,K-ATPASE regulatory protein FXYD2b in micelles. Determined by solution NMR. Released 14 May 2014.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 520
Mol. weight: 7.33 kDa
Released: 14 May 2014

Explore 2MKV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MKV contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	18-21	4
α-helix	24-49	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sodium/potassium-transporting ATPase subunit gamma	A	protein	64	Homo sapiens	P54710 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MKV_1 Sodium/potassium-transporting ATPase subunit gamma (chains A)
LDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRSGGNKKRRQIN
EDEP

Primary citation

Structure of the Na,K-ATPase regulatory protein FXYD2b in micelles: Implications for membrane-water interfacial arginines. Gong, X.M., Ding, Y., Yu, J. et al. Biochim Biophys Acta (2015) 1848:299-306. DOI 10.1016/j.bbamem.2014.04.021 · PubMed

Other PDB entries of the same protein (UniProt P54710 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7E20 2.7 Å, Cryo EM structure of a K+-bound Na+,K+-ATPase in the E2 state
7E21 2.9 Å, Cryo EM structure of a Na+-bound Na+,K+-ATPase in the E1 state with ATP-gamma-S
7E1Z 3.2 Å, Cryo EM structure of a Na+-bound Na+,K+-ATPase in the E1 state

Browse structure collections

About this viewer

MolViewer shows 2MKV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.