2MRD: Human Ca2+-loaded S100A4 cys-free mutant

Solution structure of human Ca2+-loaded S100A4 cys-free mutant. Determined by solution NMR. Released 8 Jul 2015.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,638
Mol. weight: 23.36 kDa
Released: 8 Jul 2015

Explore 2MRD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MRD contains 8 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	4-20	17
β-strand	28-30	3	1
α-helix	31-41	11
α-helix	52-62	11
β-strand	69-71	3	1
α-helix	72-88	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein S100-A4	A, B	protein	101	Homo sapiens	P26447 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2MRD_1 Protein S100-A4 (chains A, B)
MASPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMS
NLDSNRDNEVDFQEYSVFLSSIAMMSNEFFEGFPDKQPRKK

Primary citation

The solution structure of human calcium-bound S100A4 mutated at four cysteine loci. Cho, C.C., Hung, K.W., Gorja, D.R. et al. J Biomol NMR (2015) 62:233-238. DOI 10.1007/s10858-015-9927-6 · PubMed

Other PDB entries of the same protein (UniProt P26447 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CFQ 1.37 Å, Ca-bound truncated (delta13C) and C3S, C81S and C86S mutated S100A4 complexed with…
4CFR 1.4 Å, Ca-bound S100A4 C3S, C81S, C86S and F45W mutant complexed with non- muscle myosin IIA
3C1V 1.5 Å, The 1.5 A Crystal structure of Ca2+-bound S100A4
4ETO 1.54 Å, Structure of S100A4 in complex with non-muscle myosin-IIA peptide
2Q91 1.63 Å, Structure of the Ca2+-Bound Activated Form of the S100A4 Metastasis Factor
27UH 1.82 Å, Crystal structure of a de novo-designed VHH targeting S100A4
7PSQ 1.91 Å, Crystal structure of S100A4 labeled with NU074381b.
3ZWH 1.94 Å, Ca2+-bound S100A4 C3S, C81S, C86S and F45W mutant complexed with myosin IIA
3CGA 2.03 Å, Crystal structure of metastasis-associated protein S100A4 in the active, calcium-bound…
5LPU 2.1 Å, Crystal structure of Annexin A2 complexed with S100A4
4HSZ 2.25 Å, Structure of truncated (delta8C) S100A4
3KO0 2.3 Å, Structure of the tfp-ca2+-bound activated form of the s100a4 Metastasis factor

Browse structure collections

About this viewer

MolViewer shows 2MRD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.