2MS4: Cyclophilin a

Cyclophilin a complexed with a fragment of crk-ii. Determined by solution NMR. Released 9 Sept 2015.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,334
Mol. weight: 18.99 kDa
Released: 9 Sept 2015

Explore 2MS4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MS4 contains 5 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	4	1
β-strand	5-12	8	1
β-strand	15-24	10	1
α-helix	30-41	12
β-strand	52-57	6	1
β-strand	61-65	5	1
β-strand	76	1	2
β-strand	77	1	3
β-strand	80	1	3
β-strand	83	1	4
β-strand	97-99	3	1
β-strand	102	1	4
β-strand	108	1	4
β-strand	110	1	2
β-strand	112-115	4	1
α-helix	120-122	3
α-helix	127-128	2
β-strand	130-134	5	1
α-helix	136-143	8
β-strand	146	1	5
β-strand	152	1	5
β-strand	156-161	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peptidyl-prolyl cis-trans isomerase A	A	protein	165	Homo sapiens	P62937 (AlphaFold model)
Peptide	B	protein	9		P46108 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MS4_1 Peptidyl-prolyl cis-trans isomerase A (chains A)
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

Sequence of entity 2 (B), FASTA

>2MS4_2 Peptide (chains B)
PEPGPYAQP

Primary citation

Cyclophilin A promotes cell migration via the Abl-Crk signaling pathway. Saleh, T., Jankowski, W., Sriram, G. et al. Nat Chem Biol (2016) 12:117-123. DOI 10.1038/nchembio.1981 · PubMed

Other PDB entries of the same protein (UniProt P62937 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9E3S 1.08 Å, Tricomplex of RMC-9945, KRAS G12N, and CypA
9BG4 1.14 Å, Tri-complex of Compound-2, KRAS G12V, and CypA
4N1M 1.15 Å, Structure of Cyclophilin A in complex with GlyPro.
5F66 1.15 Å, High-resolution isotropic multiconformer synchrotron model of CypA at 273 K
9GHY 1.15 Å, Cyclophilin A in complex with Sanglifehrin A analogue (2R,3S,7S,10S,E)-10-(3-aminopropyl)…
6GJL 1.16 Å, Cyclophilin A complexed with tri-vector ligand 10.
6GS6 1.16 Å, Cyclophilin A single mutant D66A in complex with an inhibitor.
2X25 1.2 Å, Free acetyl-CypA orthorhombic form
4YUO 1.2 Å, High-resolution multiconformer synchrotron model of CypA at 273 K
7UXM 1.2 Å, Structure of PPIA in complex with FP29092, a Helicon Polypeptide
8TBG 1.2 Å, Tricomplex of RMC-7977, HRAS WT, and CypA
9BFV 1.2 Å, Tri-complex of Compound-23, KRAS G12C, and CypA

Browse structure collections

About this viewer

MolViewer shows 2MS4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.