4N1M: Cyclophilin A

Structure of Cyclophilin A in complex with GlyPro. Determined by X-ray diffraction at 1.15 Å resolution. Released 12 Aug 2015.

Method: X-ray diffraction
Resolution: 1.15 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,577
Mol. weight: 18.58 kDa
Ligands: GLY, PRO
Released: 12 Aug 2015

Explore 4N1M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4N1M contains 4 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	-1-4	6
β-strand	5-12	8	1
β-strand	15-24	10	1
α-helix	30-41	12
β-strand	52	1	1
β-strand	55-57	3	1
β-strand	61-64	4	1
β-strand	77-78	2	2
β-strand	80	1	2
β-strand	83	1	3
β-strand	97-100	4	1
β-strand	108	1	3
β-strand	112-115	4	1
α-helix	120-122	3
β-strand	128-134	7	1
α-helix	136-143	8
β-strand	156-164	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peptidyl-prolyl cis-trans isomerase A	A	protein	168	Homo sapiens	P62937 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4N1M_1 Peptidyl-prolyl cis-trans isomerase A (chains A)
SHMMVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRII
PGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTA
KTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

Ligands and cofactors

ID	Name	Formula	Copies
GLY	Glycine	C2 H5 N O2	1
PRO	Proline	C5 H9 N O2	1

Primary citation

Mapping the binding surface of Cyclophilin A. Mcnae, I.W., Dornan, D., Patterson, A.F. et al. To be published.

Other PDB entries of the same protein (UniProt P62937 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9E3S 1.08 Å, Tricomplex of RMC-9945, KRAS G12N, and CypA
9BG4 1.14 Å, Tri-complex of Compound-2, KRAS G12V, and CypA
5F66 1.15 Å, High-resolution isotropic multiconformer synchrotron model of CypA at 273 K
9GHY 1.15 Å, Cyclophilin A in complex with Sanglifehrin A analogue (2R,3S,7S,10S,E)-10-(3-aminopropyl)…
6GJL 1.16 Å, Cyclophilin A complexed with tri-vector ligand 10.
6GS6 1.16 Å, Cyclophilin A single mutant D66A in complex with an inhibitor.
2X25 1.2 Å, Free acetyl-CypA orthorhombic form
4YUO 1.2 Å, High-resolution multiconformer synchrotron model of CypA at 273 K
7UXM 1.2 Å, Structure of PPIA in complex with FP29092, a Helicon Polypeptide
8TBG 1.2 Å, Tricomplex of RMC-7977, HRAS WT, and CypA
9BFV 1.2 Å, Tri-complex of Compound-23, KRAS G12C, and CypA
9BFW 1.2 Å, Tri-complex of Compound-4, KRAS G12C, and CypA

Browse structure collections

About this viewer

MolViewer shows 4N1M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.