2MSX: Kunitz-type protease inhibitor 1

The solution structure of the MANEC-type domain from Hepatocyte Growth Factor Inhibitor 1 reveals an unexpected PAN/apple domain-type fold. Determined by solution NMR. Released 31 Dec 2014.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 900
Mol. weight: 12.84 kDa
Released: 31 Dec 2014

Explore 2MSX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MSX contains 5 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	50-53	4
β-strand	54-56	3	1
α-helix	57-58	2
β-strand	61-63	3	2
α-helix	66-69	4
β-strand	75-77	3	1
α-helix	84-93	10
β-strand	99-104	6	1
β-strand	113-119	7	1
β-strand	122-123	2	3
β-strand	126-127	2	3
β-strand	131-133	3	2
β-strand	137-142	6	1
α-helix	146-149	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kunitz-type protease inhibitor 1	A	protein	114	Homo sapiens	O43278 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MSX_1 Kunitz-type protease inhibitor 1 (chains A)
GADCLNSFTAGVPGFVLDTQASVSNGATFLESPTVRRGWDCVRACCTTQNCNLALVELQP
DRGEDAIAACFLINCLYEQNFVCKFAPREGFINYLTREVYRSYRQLVDHHHHHH

Primary citation

The solution structure of the MANEC-type domain from hepatocyte growth factor activator inhibitor-1 reveals an unexpected PAN/apple domain-type fold. Hong, Z., Nowakowski, M., Spronk, C. et al. Biochem J (2015) 466:299-309. DOI 10.1042/BJ20141236 · PubMed

Other PDB entries of the same protein (UniProt O43278 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ISO 2.01 Å, Crystal Structure of Matriptase in complex with its inhibitor HAI-1
5EZD 2.1 Å, Crystal structure of a Hepatocyte growth factor activator inhibitor-1 (HAI-1) fragment…
4ISL 2.29 Å, Crystal Structure of the inactive Matriptase in complex with its inhibitor HAI-1
4ISN 2.45 Å, Crystal Structure of Matriptase in complex with its inhibitor HAI-1
1YC0 2.6 Å, short form HGFA with first Kunitz domain from HAI-1
5H7V 3.82 Å, Structure of full-length extracellular domain of HAI-1 at pH 4.6

Browse structure collections

About this viewer

MolViewer shows 2MSX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.