5H7V: Kunitz-type protease inhibitor 1

Structure of full-length extracellular domain of HAI-1 at pH 4.6. Determined by X-ray diffraction at 3.82 Å resolution. Released 29 Mar 2017.

Method: X-ray diffraction
Resolution: 3.82 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,489
Mol. weight: 47.3 kDa
Released: 29 Mar 2017

Explore 5H7V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5H7V contains 8 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	50-53	4
β-strand	60-63	4	1
α-helix	69-71	3
β-strand	75	1	2
α-helix	84-92	9
β-strand	99-103	5	2
β-strand	118-119	2	2
β-strand	122	1	3
β-strand	127	1	3
β-strand	131-135	5	1
β-strand	137-140	4	2
β-strand	142	1	4
β-strand	144	1	4
β-strand	170-173	4	5
β-strand	179	1	6
β-strand	189-191	3	7
β-strand	200-203	4	6
β-strand	207-210	4	6
β-strand	216-219	4	5
β-strand	220-222	3	7
β-strand	237-240	4	5
α-helix	243-246	4
α-helix	247-251	5
β-strand	263-269	7	8
β-strand	274-280	7	8
β-strand	290	1	8
α-helix	293-299	7
α-helix	377-379	3
β-strand	388-394	7	9
β-strand	399-405	7	9
β-strand	415	1	9
α-helix	418-423	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kunitz-type protease inhibitor 1	A	protein	421	Homo sapiens	O43278 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5H7V_1 Kunitz-type protease inhibitor 1 (chains A)
RSPWPGPPPAPPGLPAGADCLNSFTAGVPGFVLDTNASVSNGATFLESPTVRRGWDCVRA
CCTTQNCNLALVELQPDRGEDAIAACFLINCLYEQNFVCKFAPREGFINYLTREVYRSYR
QLRTQGFGGSGIPKAWAGIDLKVQPQEPLVLKDVENTDWRLLRGDTDVRVERKDPNQVEL
WGLKEGTYLFQLTVTSSDHPEDTANVTVTVLSTKQTEDYCLASNKVGRCRGSFPRWYYDP
TEQICKSFVYGGCLGNKNNYLREEECILACRGVQGPSMERRHPVCSGTCQPTQFRCSNGC
CIDSFLECDDTPNCPDASDEAACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPR
WYYNPFSEHCARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPTRTGHHHHH
H

Primary citation

The crystal structure of a multidomain protease inhibitor (HAI-1) reveals the mechanism of its auto-inhibition. Liu, M., Yuan, C., Jensen, J.K. et al. J Biol Chem (2017) 292:8412-8423. DOI 10.1074/jbc.M117.779256 · PubMed

Other PDB entries of the same protein (UniProt O43278 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ISO 2.01 Å, Crystal Structure of Matriptase in complex with its inhibitor HAI-1
5EZD 2.1 Å, Crystal structure of a Hepatocyte growth factor activator inhibitor-1 (HAI-1) fragment…
4ISL 2.29 Å, Crystal Structure of the inactive Matriptase in complex with its inhibitor HAI-1
4ISN 2.45 Å, Crystal Structure of Matriptase in complex with its inhibitor HAI-1
1YC0 2.6 Å, short form HGFA with first Kunitz domain from HAI-1
2MSX The solution structure of the MANEC-type domain from Hepatocyte Growth Factor Inhibitor…

Browse structure collections

About this viewer

MolViewer shows 5H7V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.