2MWI: Carboxy-terminal domain of DNTTIP1

The structure of the carboxy-terminal domain of DNTTIP1. Determined by solution NMR. Released 18 Feb 2015.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 985
Mol. weight: 14.06 kDa
Released: 18 Feb 2015

Explore 2MWI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MWI contains 8 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	204-206	3
β-strand	213-214	2	1
α-helix	219-222	4
α-helix	231-233	3
β-strand	242-243	2	2
α-helix	249-256	8
β-strand	267-268	2	2
β-strand	269-270	2	1
α-helix	271-277	7
α-helix	291-293	3
β-strand	297	1	1
α-helix	298-300	3
α-helix	303-315	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Deoxynucleotidyltransferase terminal-interacting protein 1	A	protein	122	Homo sapiens	Q9H147 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MWI_1 Deoxynucleotidyltransferase terminal-interacting protein 1 (chains A)
GAREGPKWDPARLNESTTFVLGSRANKALGMGGTRGRIYIKHPHLFKYAADPQDKHWLAE
QHHMRATGGKMAYLLIEEDIRDLAASDDYRGCLDLKLEELKSFVLPSWMVEKMRKYMETL
RT

Primary citation

Structural and functional characterization of a cell cycle associated HDAC1/2 complex reveals the structural basis for complex assembly and nucleosome targeting. Itoh, T., Fairall, L., Muskett, F.W. et al. Nucleic Acids Res (2015) 43:2033-2044. DOI 10.1093/nar/gkv068 · PubMed

Other PDB entries of the same protein (UniProt Q9H147 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4D6K 2.1 Å, Structure of DNTTIP1 dimerisation domain.
9R4I 2.92 Å, An auto inhibitory loop in the MiDAC histone deacetylase complex
6Z2J 4.0 Å, The structure of the dimeric HDAC1/MIDEAS/DNTTIP1 MiDAC deacetylase complex
6Z2K 4.5 Å, The structure of the tetrameric HDAC1/MIDEAS/DNTTIP1 MiDAC deacetylase complex

Browse structure collections

About this viewer

MolViewer shows 2MWI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.