4D6K: DNTTIP1 dimerisation domain

Structure of DNTTIP1 dimerisation domain. Determined by X-ray diffraction at 2.1 Å resolution. Released 18 Feb 2015.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: HOMO SAPIENS
Chains: 6
Atoms: 3,504
Mol. weight: 62.55 kDa
Released: 18 Feb 2015

Explore 4D6K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4D6K contains 24 α-helices and 0 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	65-87	23
α-helix	90-103	14
α-helix	110-125	16
α-helix	126-129	4

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	63-87	25
α-helix	90-104	15
α-helix	110-125	16
α-helix	126-129	4

Chain C: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	66-87	22
α-helix	90-104	15
α-helix	110-125	16
α-helix	126-129	4

Chain D: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	64-87	24
α-helix	90-103	14
α-helix	110-125	16
α-helix	126-129	4

Chain E: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	63-87	25
α-helix	90-103	14
α-helix	110-125	16
α-helix	126-129	4

Chain F: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	67-87	21
α-helix	90-102	13
α-helix	110-125	16
α-helix	126-129	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Deoxynucleotidyltransferase terminal-interacting protein 1	A, B, C, D, E, F	protein	92	HOMO SAPIENS	Q9H147 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>4D6K_1 DEOXYNUCLEOTIDYLTRANSFERASE TERMINAL-INTERACTING PROTEIN 1 (chains A, B, C, D, E, F)
MTTSFTDPAISMDLLRAVLQPSINEEIQTVFNKYMKFFQKAALNVRDNVGEEVDAEQLIQ
EACRSCLEQAKLLFSDGEKVIPRLTHELPGIK

Primary citation

Structural and Functional Characterization of a Cell Cycle Associated Hdac1/2 Complex Reveals the Structural Basis for Complex Assembly and Nucleosome Targeting. Itoh, T., Fairall, L., Muskett, F.W. et al. Nucleic Acids Res (2015) 43:2033. DOI 10.1093/NAR/GKV068 · PubMed

Other PDB entries of the same protein (UniProt Q9H147 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9R4I 2.92 Å, An auto inhibitory loop in the MiDAC histone deacetylase complex
6Z2J 4.0 Å, The structure of the dimeric HDAC1/MIDEAS/DNTTIP1 MiDAC deacetylase complex
6Z2K 4.5 Å, The structure of the tetrameric HDAC1/MIDEAS/DNTTIP1 MiDAC deacetylase complex
2MWI The structure of the carboxy-terminal domain of DNTTIP1

Browse structure collections

About this viewer

MolViewer shows 4D6K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.