2MXY: HnRNP C RRM

Solution structure of hnRNP C RRM in complex with 5'-AUUUUUC-3' RNA. Determined by solution NMR. Released 25 Feb 2015.

Method: Solution NMR
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 930
Mol. weight: 13.41 kDa
Released: 25 Feb 2015

Explore 2MXY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MXY contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	17-21	5	1
α-helix	30-36	7
β-strand	43-48	6	1
β-strand	52-57	6	1
α-helix	60-67	8
β-strand	74-75	2	2
β-strand	78-79	2	2
β-strand	81-84	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heterogeneous nuclear ribonucleoproteins C1/C2	A	protein	105	Homo sapiens	P07910 (AlphaFold model)
5'-r(apupupupupup*c)-3'	B	RNA	7	synthetic construct

Sequence of entity 1 (A), FASTA

>2MXY_1 Heterogeneous nuclear ribonucleoproteins C1/C2 (chains A)
ASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNER
NARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYG

Sequence of entity 2 (B), FASTA

>2MXY_2 5'-R(*AP*UP*UP*UP*UP*UP*C)-3' (chains B)
AUUUUUC

Primary citation

Structural and mechanistic insights into poly(uridine) tract recognition by the hnRNP C RNA recognition motif. Cienikova, Z., Damberger, F.F., Hall, J. et al. J Am Chem Soc (2014) 136:14536-14544. DOI 10.1021/ja507690d · PubMed

Other PDB entries of the same protein (UniProt P07910 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3LN4 1.3 Å, Crystal structure of HLA-B*4103 in complex with a 16mer self-peptide derived from…
1TXP Heterogeneous Nuclear Ribonucleoprotein (hnRNP) C Oligomerization Domain Tetramer
1WF2 Solution structure of RRM domain in HNRPC protein
2MZ1 Solution structure of hnRNP C RRM in complex with 5'-UUUUC-3' RNA

Browse structure collections

About this viewer

MolViewer shows 2MXY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.