2MYS: Myosin

Myosin subfragment-1, alpha carbon coordinates only for the two light chains. Determined by X-ray diffraction at 2.8 Å resolution. Released 11 Jan 1997.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Gallus gallus
Chains: 3
Atoms: 6,788
Mol. weight: 131.67 kDa
Ligands: MG
Released: 11 Jan 1997

Explore 2MYS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MYS contains 37 α-helices and 31 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 37 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	14-17	4
α-helix	25-28	4
β-strand	37-41	5	1
β-strand	47-51	5	1
β-strand	52-55	4	2
β-strand	59-62	4	2
β-strand	70-73	4	2
α-helix	74-76	3
β-strand	77-78	2	1
β-strand	90	1	3
α-helix	91-93	3
α-helix	99-108	10
β-strand	116-118	3	3
β-strand	123-126	4	3
α-helix	133-135	3
α-helix	139-142	4
α-helix	155-165	11
α-helix	166-170	5
β-strand	173-179	7	3
α-helix	185-199	15
α-helix	218-233	16
β-strand	234-235	2	4
β-strand	243-244	2	4
β-strand	247-254	8	3
β-strand	260-262	3	3
β-strand	265-268	4	3
α-helix	272-275	4
β-strand	285	1	4
α-helix	286-291	6
α-helix	297-303	7
α-helix	309-311	3
α-helix	313-315	3
α-helix	327-340	14
α-helix	345-361	17
β-strand	366-368	3	5
α-helix	369	1
β-strand	375-377	3	5
α-helix	382-390	9
α-helix	394-402	9
β-strand	405	1	6
β-strand	414	1	6
α-helix	419-448	30
β-strand	457-465	9	3
β-strand	473	1	7
α-helix	475-505	31
α-helix	517-527	11
α-helix	532-539	8
α-helix	547-558	12
β-strand	559	1	8
β-strand	562	1	8
β-strand	565-566	2	7
β-strand	579-582	4	7
β-strand	587-590	4	7
α-helix	595-600	6
α-helix	605-612	8
α-helix	617-622	6
α-helix	650-665	16
β-strand	668-675	8	3
α-helix	688-698	11
α-helix	700-707	8
β-strand	714-716	3	9
α-helix	717-724	8
α-helix	725-727	3
α-helix	742-747	6
β-strand	758-761	4	9
β-strand	764-767	4	9
α-helix	771-826	56
α-helix	830-838	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin	A	protein	843	Gallus gallus	P13538 (AlphaFold model)
Myosin	B	protein	166	Gallus gallus	P02609 (AlphaFold model)
Myosin	C	protein	149	Gallus gallus	P02604 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MYS_1 MYOSIN (chains A)
ASPDAEMAAFGEAAPYLRKSEKERIEAQNKPFDAKSSVFVVHPKQSFVKGTIQSKEGGKV
TVKTEGGETLTVKEDQVFSMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSG
LFCVTVNPYKWLPVYNPKVVLAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGE
SGAGKTVNTKRVIQYFATIAASGEKKKEEQSGKMQGTLEDQIISANPLLEAFGNAKTVRN
DNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVTFQLPAERSYHIFYQIMSNKKPELI
DMLLITTNPYDYHYVSEGEITVPSIDDQEELMATDSAIDILGFSADEKTAIYKLTGAVMH
YGNLKFKQKQREEQAEPDGTEVADKAAYLMGLNSAELLKALCYPRVGVGNEAVTKGETVS
EVHNSVGALAKAVYEKMFLWMVIRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSFEQLCI
NFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSILEEEC
MFPKATDTSFKNKLYDEHLGKSNNFQKPKPAKGKAEAHFSLVHYAGTVDYNISGWLEKNK
DPLNETVIGLYQKSSVKTLALLFATYGGEAEGGGGKKGGKKKGSSFQTVSALFRENLNKL
MANLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRVLYADF
KQRYRVLNASAIPEGQFMDSKKASEKLLGGGDVDHTQYAFGHTKVFFKAGLLGLLEEMRD
DKLAEIITATQARCRGFLMRVEYRAMVERRESIFCIQYNVRSFMNVKHWPWMKLFFKIKP
LLK

Sequence of entity 2 (B), FASTA

>2MYS_2 MYOSIN (chains B)
PKKAKRRAAEGSSNVFSMFDETEIEDFKEAFTVIDQNADGIIDKDDLRETFAAMGRLNVK
NEELDAMIKEASGPINFTVFLTMFGEKLKGADPEDVIMGAFKVLDPDGKGSIKKSFLEEL
LTTGGGRFTPEEIKNMWAAFPPDVAGNVDYKNICYVITHGEDAEGE

Sequence of entity 3 (C), FASTA

>2MYS_3 MYOSIN (chains C)
EFSKAAADDFKEAFLLFDRTGDAKITASQVGDIARALGQNPTNAEINKILGNPSKEEMNA
AAITFEEFLPMLQAAANNKDQGTFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTE
EEVEELMKGQEDSNGCINYEAFVKHIMSV

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Three-dimensional structure of myosin subfragment-1: a molecular motor. Rayment, I., Rypniewski, W.R., Schmidt-Base, K. et al. Science (1993) 261:50-58. PubMed

Other PDB entries of the same protein (UniProt P13538 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1M8Q 70.0 Å, Molecular Models of Averaged Rigor Crossbridges from Tomograms of Insect Flight Muscle
1MVW 70.0 Å, Molecular models of averaged rigor crossbridges from tomograms of insect flight muscle
1O18 70.0 Å, Molecular models of averaged rigor crossbridges from tomograms of insect flight muscle
1O19 70.0 Å, Molecular models of averaged rigor crossbridges from tomograms of insect flight muscle
1O1A 70.0 Å, Molecular models of averaged rigor crossbridges from tomograms of insect flight muscle
1O1B 70.0 Å, Molecular models of averaged rigor crossbridges from tomograms of insect flight muscle
1O1C 70.0 Å, Molecular models of averaged rigor crossbridges from tomograms of insect flight muscle
1O1D 70.0 Å, Molecular models of averaged rigor crossbridges from tomograms of insect flight muscle
1O1E 70.0 Å, Molecular models of averaged rigor crossbridges from tomograms of insect flight muscle
1O1F 70.0 Å, Molecular models of averaged rigor crossbridges from tomograms of insect flight muscle
1O1G 70.0 Å, Molecular models of averaged rigor crossbridges from tomograms of insect flight muscle
2W4A Isometrically contracting insect asynchronous flight muscle

Browse more

2MYS is part of these collections:

Motor proteins and the cytoskeleton

About this viewer

MolViewer shows 2MYS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.