2N2H: Sds3

Solution structure of Sds3 in complex with Sin3A. Determined by solution NMR. Released 15 Jul 2015.

Method: Solution NMR
Organism: Mus musculus
Chains: 2
Atoms: 1,252
Mol. weight: 17.82 kDa
Released: 15 Jul 2015

Explore 2N2H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2N2H contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	211-212	2
α-helix	213-223	11

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	616-641	26
α-helix	646-651	6
α-helix	663-673	11
α-helix	675-677	3
α-helix	678-685	8
α-helix	689-711	23
α-helix	712-716	5
α-helix	717-723	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sin3 histone deacetylase corepressor complex component SDS3	A	protein	27	Mus musculus	Q8BR65 (AlphaFold model)
Paired amphipathic helix protein Sin3a	B	protein	125	Mus musculus	Q60520 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2N2H_1 Sin3 histone deacetylase corepressor complex component SDS3 (chains A)
SNAAQLNYLLTDEQIMEDLRTLNKLKS

Sequence of entity 2 (B), FASTA

>2N2H_2 Paired amphipathic helix protein Sin3a (chains B)
SNAEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEV
IHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEK
YYLKS

Primary citation

Structural insights into the assembly of the histone deacetylase-associated Sin3L/Rpd3L corepressor complex. Clark, M.D., Marcum, R., Graveline, R. et al. Proc Natl Acad Sci U S A (2015) 112:E3669-E3678. DOI 10.1073/pnas.1504021112 · PubMed

Other PDB entries of the same protein (UniProt Q8BR65 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ZQA 1.65 Å, Crystal Structure of the Sds3 Dimerization Domain
7SXI Solution Structure of Sds3 Capped Tudor Domain

Browse structure collections

About this viewer

MolViewer shows 2N2H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.