Ensemble solution structure of the phosphoenolpyruvate-Enzyme I complex from the bacterial phosphotransferase system. Determined by solution NMR. Released 2 Sept 2015.
Explore 2N5T in 3D Show helices and sheets RCSB PDB PDBe
2N5T contains 59 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8 | 1 | 1 |
| β-strand | 12-18 | 7 | 1 |
| α-helix | 30-32 | 3 | |
| α-helix | 33-64 | 32 | |
| α-helix | 67-80 | 14 | |
| α-helix | 83-91 | 9 | |
| α-helix | 92-96 | 5 | |
| α-helix | 100-116 | 17 | |
| α-helix | 121-142 | 22 | |
| β-strand | 156-160 | 5 | 1 |
| α-helix | 165-169 | 5 | |
| β-strand | 176-181 | 6 | 1 |
| α-helix | 189-197 | 9 | |
| β-strand | 201-202 | 2 | 1 |
| β-strand | 216-220 | 5 | 1 |
| β-strand | 227-229 | 3 | 1 |
| α-helix | 233-253 | 21 | |
| β-strand | 262 | 1 | 2 |
| β-strand | 268 | 1 | 2 |
| β-strand | 270-275 | 6 | 3 |
| α-helix | 279-286 | 8 | |
| β-strand | 292-296 | 5 | 3 |
| α-helix | 297-301 | 5 | |
| α-helix | 310-323 | 14 | |
| β-strand | 329-332 | 4 | 3 |
| α-helix | 333-334 | 2 | |
| α-helix | 343-345 | 3 | |
| α-helix | 347-349 | 3 | |
| α-helix | 353-355 | 3 | |
| α-helix | 360-363 | 4 | |
| α-helix | 367-380 | 14 | |
| β-strand | 386-390 | 5 | 3 |
| α-helix | 396-415 | 20 | |
| β-strand | 425-430 | 6 | 3 |
| α-helix | 433-437 | 5 | |
| α-helix | 439-443 | 5 | |
| β-strand | 448-451 | 4 | 3 |
| α-helix | 453-460 | 8 | |
| α-helix | 468-473 | 6 | |
| α-helix | 479-494 | 16 | |
| β-strand | 498-501 | 4 | 3 |
| α-helix | 512-517 | 6 | |
| β-strand | 522-525 | 4 | 3 |
| α-helix | 527-529 | 3 | |
| α-helix | 530-538 | 9 | |
| α-helix | 542-554 | 13 | |
| α-helix | 558-572 | 15 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8 | 1 | 4 |
| β-strand | 12-18 | 7 | 4 |
| α-helix | 33-64 | 32 | |
| α-helix | 67-80 | 14 | |
| α-helix | 83-91 | 9 | |
| α-helix | 92-96 | 5 | |
| α-helix | 100-116 | 17 | |
| α-helix | 121-142 | 22 | |
| β-strand | 156-160 | 5 | 4 |
| α-helix | 165-169 | 5 | |
| β-strand | 176-181 | 6 | 4 |
| α-helix | 189-197 | 9 | |
| β-strand | 201-202 | 2 | 4 |
| β-strand | 216-220 | 5 | 4 |
| β-strand | 227-229 | 3 | 4 |
| α-helix | 233-253 | 21 | |
| β-strand | 262 | 1 | 5 |
| β-strand | 268 | 1 | 5 |
| β-strand | 270-275 | 6 | 6 |
| α-helix | 279-286 | 8 | |
| β-strand | 292-296 | 5 | 6 |
| α-helix | 297-301 | 5 | |
| α-helix | 310-323 | 14 | |
| β-strand | 329-332 | 4 | 6 |
| α-helix | 333-334 | 2 | |
| α-helix | 343-345 | 3 | |
| α-helix | 347-349 | 3 | |
| α-helix | 353-355 | 3 | |
| α-helix | 360-363 | 4 | |
| α-helix | 367-380 | 14 | |
| β-strand | 386-390 | 5 | 6 |
| α-helix | 396-415 | 20 | |
| β-strand | 425-430 | 6 | 6 |
| α-helix | 433-437 | 5 | |
| α-helix | 439-443 | 5 | |
| β-strand | 448-451 | 4 | 6 |
| α-helix | 453-460 | 8 | |
| α-helix | 468-473 | 6 | |
| α-helix | 479-494 | 16 | |
| β-strand | 498-501 | 4 | 6 |
| α-helix | 512-517 | 6 | |
| β-strand | 522-525 | 4 | 6 |
| α-helix | 527-529 | 3 | |
| α-helix | 530-538 | 9 | |
| α-helix | 542-554 | 13 | |
| α-helix | 558-572 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phosphoenolpyruvate-protein phosphotransferase | A, B | protein | 575 | Escherichia coli | P08839 (AlphaFold model) |
>2N5T_1 Phosphoenolpyruvate-protein phosphotransferase (chains A, B) MISGILASPGIAFGKALLLKEDEIVIDRKKISADQVDQEVERFLSGRAKASAQLETIKTK AGETFGEEKEAIFEGHIMLLEDEELEQEIIALIKDKHMTADAAAHEVIEGQASALEELDD EYLKERAADVRDIGKRLLRNILGLKIIDLSAIQDEVILVAADLTPSETAQLNLKKVLGFI TDAGGRTSHTSIMARSLELPAIVGTGSVTSQVKNDDYLILDAVNNQVYVNPTNEVIDKMR AVQEQVASEKAELAKLKDLPAITLDGHQVEVCANIGTVRDVEGAERNGAEGVGLYRTEFL FMDRDALPTEEEQFAAYKAVAEACGSQAVIVRTMDIGGDKELPYMNFPKEENPFLGWRAI RIAMDRREILRDQLRAILRASAFGKLRIMFPMIISVEEVRALRKEIEIYKQELRDEGKAF DESIEIGVMVETPAAATIARHLAKEVDFFSIGTNDLTQYTLAVDRGNDMISHLYQPMSPS VLNLIKQVIDASHAEGKWTGMCGELAGDERATLLLLGMGLDEFSMSAISIPRIKKIIRNT NFEDAKVLAEQALAQPTTDELMTLVNKFIEEKTIC
Dynamic equilibrium between closed and partially closed states of the bacterial Enzyme I unveiled by solution NMR and X-ray scattering. Venditti, V., Schwieters, C.D., Grishaev, A. et al. Proc Natl Acad Sci U S A (2015) 112:11565-11570. DOI 10.1073/pnas.1515366112 · PubMed
Other PDB entries of the same protein (UniProt P08839 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2N5T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.