2N5X: C-terminal domain of Cdc37 cochaperone

Name: PDB 2N5X: C-terminal domain of Cdc37 cochaperone
Published: 2015-10-07
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

C-terminal domain of Cdc37 cochaperone. Determined by solution NMR. Released 7 Oct 2015.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 710
Mol. weight: 10.2 kDa
Released: 7 Oct 2015

Explore 2N5X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2N5X contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	294-299	6
α-helix	303-310	8
α-helix	314-323	10
α-helix	326-338	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hsp90 co-chaperone Cdc37	A	protein	94	Homo sapiens	Q16543 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2N5X_1 Hsp90 co-chaperone Cdc37 (chains A)
GHMGPGGLDPVEVYESLPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVP
NSKASEAKEGEEAGPGDPLLEAVPKTGDEKDVSV

Primary citation

The C-terminal domain of human Cdc37 studied by solution NMR. Zhang, Z., Keramisanou, D., Dudhat, A. et al. J Biomol NMR (2015) 63:315-321. DOI 10.1007/s10858-015-9988-6 · PubMed

Other PDB entries of the same protein (UniProt Q16543 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2W0G 1.88 Å, HSP90 co-chaperone CDC37
5HPE 2.27 Å, Phosphatase domain of PP5 bound to a phosphomimetic Cdc37 substrate peptide
1US7 2.3 Å, Complex of Hsp90 and P50
9KQN 2.84 Å, Hsp90-Cdc37-PINK1 complex
7Z38 3.16 Å, Structure of the RAF1-HSP90-CDC37 complex (RHC-I)
8GAE 3.3 Å, Hsp90 provides platform for CRaf dephosphorylation by PP5
7ZR0 3.4 Å, CryoEM structure of HSP90-CDC37-BRAF(V600E) complex.
7Z37 3.67 Å, Structure of the RAF1-HSP90-CDC37 complex (RHC-II)
8U1L 3.7 Å, Cryo-EM structure of the RAF1-HSP90-CDC37 complex in the closed state
8GFT 3.8 Å, Hsp90 provides platform for CRaf dephosphorylation by PP5
5FWK 3.9 Å, Atomic cryoEM structure of Hsp90-Cdc37-Cdk4 complex
7ZR5 3.9 Å, CryoEM structure of HSP90-CDC37-BRAF(V600E)-PP5(closed) complex

Browse structure collections

About this viewer

MolViewer shows 2N5X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.