9KQN: Hsp90-Cdc37-PINK1 complex

Hsp90-Cdc37-PINK1 complex. Determined by electron microscopy at 2.84 Å resolution. Released 15 Oct 2025.

Method: Electron microscopy
Resolution: 2.84 Å
Organism: Homo sapiens
Chains: 4
Atoms: 14,292
Mol. weight: 269.12 kDa
Ligands: ADP
Released: 15 Oct 2025

Explore 9KQN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9KQN contains 84 α-helices and 66 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 29 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	18-21	4	1
β-strand	23-24	2	2
α-helix	26-32	7
α-helix	33-37	5
α-helix	41-43	3
α-helix	44-65	22
α-helix	67-71	5
β-strand	78-83	6	3
β-strand	88-93	6	3
α-helix	100-102	3
α-helix	103-108	6
β-strand	110	1	4
α-helix	114-121	8
α-helix	138-143	6
β-strand	145-153	9	3
β-strand	160-164	5	3
β-strand	169-174	6	3
β-strand	183-190	8	3
α-helix	192-198	7
α-helix	200-209	10
α-helix	217	1
β-strand	218-222	5	3
β-strand	286-289	4	3
α-helix	294-295	2
α-helix	300	1
α-helix	306-316	11
β-strand	323-332	10	5
β-strand	336-344	9	5
β-strand	362-365	4	5
β-strand	368-372	5	5
α-helix	380-382	3
β-strand	386-391	6	5
β-strand	396	1	6
β-strand	403	1	6
α-helix	407-427	21
α-helix	431-451	21
α-helix	456-460	5
β-strand	465-467	3	7
β-strand	470-475	6	7
α-helix	477-482	6
β-strand	490-495	6	7
α-helix	499-503	5
α-helix	508-514	7
β-strand	518-521	4	7
α-helix	524-530	7
β-strand	535-536	2	7
β-strand	539-543	5	7
α-helix	555-578	24
β-strand	585-588	4	8
β-strand	597-601	5	8
α-helix	608-615	8
α-helix	622-627	6
β-strand	632-636	5	8
α-helix	641-652	12
α-helix	657-673	17
α-helix	681-695	15

Chain B: 28 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	18-21	4	3
β-strand	24	1	4
α-helix	26-36	11
α-helix	44-65	22
α-helix	69-71	3
β-strand	78-83	6	1
β-strand	88-93	6	1
α-helix	100-102	3
α-helix	103-107	5
β-strand	109-110	2	2
α-helix	114-121	8
α-helix	123	1
α-helix	137-143	7
β-strand	145	1	9
β-strand	148-153	6	1
β-strand	160-164	5	1
β-strand	169-174	6	1
β-strand	183-187	5	1
β-strand	190	1	9
α-helix	196-198	3
α-helix	200-209	10
β-strand	218-223	6	1
β-strand	285-289	5	1
α-helix	294-295	2
α-helix	306-316	11
β-strand	323-333	11	10
β-strand	337-344	8	10
β-strand	362-365	4	10
β-strand	368-372	5	10
α-helix	375-377	3
α-helix	380-382	3
β-strand	386-391	6	10
β-strand	396	1	11
β-strand	403	1	11
α-helix	407-427	21
α-helix	431-451	21
α-helix	456-460	5
β-strand	465	1	12
β-strand	466-467	2	13
β-strand	475	1	12
α-helix	477-482	6
β-strand	490-495	6	13
α-helix	499-503	5
α-helix	508-514	7
β-strand	519-521	3	13
α-helix	524-530	7
β-strand	535-536	2	13
β-strand	539-543	5	13
β-strand	546	1	14
α-helix	555-578	24
β-strand	585-588	4	14
β-strand	597-601	5	14
α-helix	606-607	2
α-helix	608-616	9
α-helix	622-627	6
β-strand	632-636	5	14
α-helix	641-652	12
α-helix	657-673	17
α-helix	681-696	16

Chain C: 15 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	323-324	2	15
α-helix	325-331	7
α-helix	336-356	21
β-strand	369-372	4	15
β-strand	378-381	4	15
β-strand	382	1	16
α-helix	434-446	13
α-helix	449-451	3
α-helix	453-456	4
α-helix	466-467	2
α-helix	472-475	4
α-helix	480-489	10
α-helix	498-499	2
α-helix	500-507	8
α-helix	508-512	5
α-helix	520-522	3
α-helix	529-537	9
α-helix	550-558	9
α-helix	564-579	16

Chain E: 12 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
β-strand	10	1	17
β-strand	23	1	16
α-helix	25-73	49
α-helix	78-111	34
β-strand	114	1	17
α-helix	116-119	4
β-strand	120-129	10	10
α-helix	156-165	10
α-helix	168-175	8
α-helix	179-181	3
α-helix	184-197	14
α-helix	203-224	22
α-helix	230-238	9
α-helix	244-248	5
α-helix	252-272	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock protein HSP 90-alpha	A, B	protein	732	Homo sapiens	P07900 (AlphaFold model)
Serine/threonine-protein kinase PINK1, mitochondrial	C	protein	494	Homo sapiens	Q9BXM7 (AlphaFold model)
Hsp90 co-chaperone Cdc37	E	protein	378	Homo sapiens	Q16543 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9KQN_1 Heat shock protein HSP 90-alpha (chains A, B)
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKED
KEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRN
PDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNN
IKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKC
LELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDY
CTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKT
LVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIV
TSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVK
DLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLE
GDDDTSRMEEVD

Sequence of entity 2 (C), FASTA

>9KQN_2 Serine/threonine-protein kinase PINK1, mitochondrial (chains C)
LIEEKQAESRRAVSACQEIQAIFTQKSKPGPDPLDTRRLQGFRLEEYLIGQSIGKGCSAA
VYEATMPTLPQNLEVTKSTGLLPGRGPGTSAPGEGQERAPGAPAFPLAIKMMWNISAGSS
SEAILNTMSQELVPASRVALAGEYGAVTYRKSKRGPKQLAPHPNIIRVLRAFTSSVPLLP
GALVDYPDVLPSRLHPEGLGHGRTLFLVMKNYPCTLRQYLCVNTPSPRLAAMMLLQLLEG
VDHLVQQGIAHRDLKSDNILVELDPDGCPWLVIADFGCCLADESIGLQLPFSSWYVDRGG
NGCLMAPEVSTARPGPRAVIDYSKADAWAVGAIAYEIFGLVNPFYGQGKAHLESRSYQEA
QLPALPESVPPDVRQLVRALLQREASKRPSARVAANVLHLSLWGEHILALKNLKLDKMVG
WLLQQSAATLLANRLTEKCCVETKMKMLFLANLECETLCQAALLLCSWRAALDYKDHDGG
YKDHDIDYKDDDDK

Sequence of entity 3 (E), FASTA

>9KQN_3 Hsp90 co-chaperone Cdc37 (chains E)
MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECKRK
VAECQRKLKELEVAEGGKAELERLQAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLS
KDGFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVH
LVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTK
IKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEEEERKKRLGPGGLDPVEVYES
LPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSKASEAKEGEEAGPG
DPLLEAVPKTGDEKDVSV

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2

Primary citation

Human Hsp90-Cdc37-PINK1 complex. Tian, X.Y., Su, J.Y. To be published.

Other PDB entries of the same protein (UniProt P07900 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TN5 1.17 Å, Rapid optimisation of fragments and hits to lead compounds from screening of crude…
5J80 1.17 Å, Crystal Structure of Apo Hsp90-alpha N-domain L107A mutant
3T0H 1.2 Å, Structure insights into mechanisms of ATP hydrolysis and the activation of human Hsp90
5J2X 1.22 Å, Crystal Structure of Hsp90-alpha N-domain in complex with…
3T10 1.24 Å, HSP90 N-terminal domain bound to ACP
6TN4 1.27 Å, Rapid optimisation of fragments and hits to lead compounds from screening of crude…
3WHA 1.3 Å, Hsp90 alpha N-terminal domain in complex with a tricyclic inhibitor
5XRD 1.3 Å, Crystal Structure of the human Hsp90-alpha N-domain bound to the hsp90 inhibitor FS7
2YK9 1.32 Å, Tricyclic series of Hsp90 inhibitors
5LRL 1.33 Å, Crystal structure of HSP90 in complex with A003492875
6GR5 1.34 Å, Structure of human Heat shock protein 90-alpha N-terminal domain (Hsp90-NTD) variant…
3B28 1.35 Å, Hsp90 alpha N-terminal domain in complex with an inhibitor CH5015765

Browse structure collections

About this viewer

MolViewer shows 9KQN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.