2NCA: Hsp90 co-chaperone Cdc37

Name: PDB 2NCA: Structural Model for the N-terminal Domain of Human Cdc37
Published: 2016-05-04
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Structural Model for the N-terminal Domain of Human Cdc37. Determined by solution NMR. Released 4 May 2016.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,062
Mol. weight: 15.41 kDa
Released: 4 May 2016

Explore 2NCA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2NCA contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	26-72	47
α-helix	79-109	31
α-helix	113-116	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hsp90 co-chaperone Cdc37	A	protein	128	Homo sapiens	Q16543 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2NCA_1 Hsp90 co-chaperone Cdc37 (chains A)
GHMVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECK
RKVAECQRKLKELEVAEGGKAELERLQAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDT
LSKDGFSK

Primary citation

Molecular Mechanism of Protein Kinase Recognition and Sorting by the Hsp90 Kinome-Specific Cochaperone Cdc37. Keramisanou, D., Aboalroub, A., Zhang, Z. et al. Mol Cell (2016) 62:260-271. DOI 10.1016/j.molcel.2016.04.005 · PubMed

Other PDB entries of the same protein (UniProt Q16543 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2W0G 1.88 Å, HSP90 co-chaperone CDC37
5HPE 2.27 Å, Phosphatase domain of PP5 bound to a phosphomimetic Cdc37 substrate peptide
1US7 2.3 Å, Complex of Hsp90 and P50
9KQN 2.84 Å, Hsp90-Cdc37-PINK1 complex
7Z38 3.16 Å, Structure of the RAF1-HSP90-CDC37 complex (RHC-I)
8GAE 3.3 Å, Hsp90 provides platform for CRaf dephosphorylation by PP5
7ZR0 3.4 Å, CryoEM structure of HSP90-CDC37-BRAF(V600E) complex.
7Z37 3.67 Å, Structure of the RAF1-HSP90-CDC37 complex (RHC-II)
8U1L 3.7 Å, Cryo-EM structure of the RAF1-HSP90-CDC37 complex in the closed state
8GFT 3.8 Å, Hsp90 provides platform for CRaf dephosphorylation by PP5
5FWK 3.9 Å, Atomic cryoEM structure of Hsp90-Cdc37-Cdk4 complex
7ZR5 3.9 Å, CryoEM structure of HSP90-CDC37-BRAF(V600E)-PP5(closed) complex

Browse structure collections

About this viewer

MolViewer shows 2NCA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.