2NLL: Protein

Retinoid X receptor-thyroid hormone receptor DNA-binding domain heterodimer bound to thyroid response element DNA. Determined by X-ray diffraction at 1.9 Å resolution. Released 12 Mar 1997.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,351
Mol. weight: 31.36 kDa
Ligands: ZN
Released: 12 Mar 1997

Explore 2NLL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2NLL contains 9 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	141-142	2
β-strand	145-146	2	1
β-strand	149-150	2	1
α-helix	153-164	12
α-helix	188-197	10

Chain B: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	302	1	2
β-strand	309	1	2
β-strand	313-314	2	3
β-strand	317-318	2	3
α-helix	321-332	12
α-helix	336-338	3
α-helix	358-367	10
α-helix	372-374	3
α-helix	378-391	14
α-helix	394-401	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-D(CPAPGPGPTPCPAPTPTP(5IU)PCPAPGPGPTPCPAPG)-3')	C	DNA	18
DNA (5'-d(cptpgpapcpcptpgpapapaptpgpapcpcpt pg)-3')	D	DNA	18
Protein (retinoic acid receptor)	A	protein	66	Homo sapiens	P19793 (AlphaFold model)
Protein (thyroid hormone receptor)	B	protein	103	Homo sapiens	P10828 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>2NLL_1 DNA (5'-D(*CP*AP*GP*GP*TP*CP*AP*TP*TP*(5IU)P*CP*AP*GP*GP*TP*CP*AP*G)-3') (chains C)
CAGGTCATTUCAGGTCAG

Sequence of entity 2 (D), FASTA

>2NLL_2 DNA (5'-D(*CP*TP*GP*AP*CP*CP*TP*GP*AP*AP*AP*TP*GP*AP*CP*CP*T P*G)-3') (chains D)
CTGACCTGAAATGACCTG

Sequence of entity 3 (A), FASTA

>2NLL_3 PROTEIN (RETINOIC ACID RECEPTOR) (chains A)
CAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQK
CLAMGM

Sequence of entity 4 (B), FASTA

>2NLL_4 PROTEIN (THYROID HORMONE RECEPTOR) (chains B)
DELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQE
CRFKKCIYVGMATDLVLDDSKRLAKRKLIEENREKRRREELEK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Structural determinants of nuclear receptor assembly on DNA direct repeats. Rastinejad, F., Perlmann, T., Evans, R.M. et al. Nature (1995) 375:203-211. DOI 10.1038/375203a0 · PubMed

Other PDB entries of the same protein (UniProt P19793 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9QX6 1.46 Å, Crystal structure of RXR alpha LBD bound to a synthetic agonist FN537 and a coactivator…
6LB4 1.5 Å, Crystal structure of dimeric RXR-LBD complexed with NEt-3ME and TIF2 co-activator
7A77 1.5 Å, Crystal structure of RXR alpha LBD in complexes with palmitic acid and GRIP-1 peptide
6FBQ 1.6 Å, Crystal Structure of the Human Retinoid X Receptor DNA-Binding Domain Bound to the Human…
9RMR 1.65 Å, Crystal structure of RXR alpha LBD bound to a synthetic agonist FN558 and a coactivator…
1DSZ 1.7 Å, Structure of the rxr/rar DNA-binding domain heterodimer in complex with the retinoic…
5MKU 1.78 Å, Crystal structure of the Retinoid X Receptor alpha in complex with synthetic honokiol…
2P1T 1.8 Å, Crystal structure of the ligand binding domain of the retinoid X receptor alpha in…
4ZSH 1.8 Å, RXR LBD in complex with 9-cis-13,14-dihydroretinoic acid
6L6K 1.8 Å, Crystal structure of dimeric RXRalpha-LBD complexed with partial agonist CBt-PMN and SRC1
7UW2 1.88 Å, Crystal structure of human Retinoid X receptor alpha ligand binding domain complex with…
6STI 1.89 Å, Crystal structure of RXRalpha LBD in complex with LG 100754 and a coactivator peptide

Browse structure collections

About this viewer

MolViewer shows 2NLL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.