2NO8: Colicin-E2 immunity protein

NMR Structure analysis of the colicin immuntiy protein IM2. Determined by solution NMR. Released 6 Nov 2007.

Method: Solution NMR
Organism: Escherichia coli
Chains: 1
Atoms: 696
Mol. weight: 10.01 kDa
Released: 6 Nov 2007

Explore 2NO8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2NO8 contains 5 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	11	1	1
α-helix	12-24	13
α-helix	30-44	15
α-helix	49-54	6
α-helix	64-78	15
β-strand	84	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Colicin-E2 immunity protein	A	protein	86	Escherichia coli	P04482 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2NO8_1 Colicin-E2 immunity protein (chains A)
MELKHSISDYTEAEFLEFVKKICRAEGATEEDDNKLVREFERLTEHPDGSDLIYYPRDDR
EDSPEGIVKEIKEWRAANGKSGFKQG

Primary citation

Structural Models for non Cognate Complexes of the DNase Domain of Colicin E9 and Colicin Immunity Proteins. Boetzel, R., Morel, B., Macdonald, C.J. et al. To be published.

Other PDB entries of the same protein (UniProt P04482 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3U43 1.72 Å, Crystal structure of the colicin E2 DNase-Im2 complex
2WPT 1.78 Å, The crystal structure of Im2 in complex with colicin E9 DNase

Browse structure collections

About this viewer

MolViewer shows 2NO8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.