Murine inducible nitric oxide synthase oxygenase domain (delta 114), aminoguanidine complex. Determined by X-ray diffraction at 2.3 Å resolution. Released 14 Oct 1998.
Explore 2NOS in 3D Show helices and sheets RCSB PDB PDBe
2NOS contains 18 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 116-118 | 3 | |
| β-strand | 120 | 1 | 1 |
| α-helix | 127-129 | 3 | |
| α-helix | 130-146 | 17 | |
| α-helix | 153-170 | 18 | |
| α-helix | 177-189 | 13 | |
| α-helix | 195-199 | 5 | |
| β-strand | 204-207 | 4 | 2 |
| α-helix | 214-229 | 16 | |
| α-helix | 230-232 | 3 | |
| β-strand | 237-240 | 4 | 2 |
| α-helix | 242-244 | 3 | |
| β-strand | 252-253 | 2 | 3 |
| β-strand | 257 | 1 | 2 |
| β-strand | 261 | 1 | 4 |
| β-strand | 263-265 | 3 | 5 |
| β-strand | 271-273 | 3 | 5 |
| α-helix | 275-277 | 3 | |
| α-helix | 278-286 | 9 | |
| α-helix | 297 | 1 | |
| β-strand | 298 | 1 | 4 |
| α-helix | 299 | 1 | |
| β-strand | 301-304 | 4 | 3 |
| β-strand | 311-313 | 3 | 3 |
| α-helix | 314-316 | 3 | |
| α-helix | 317-319 | 3 | |
| β-strand | 322-324 | 3 | 6 |
| β-strand | 339-341 | 3 | 6 |
| β-strand | 345-346 | 2 | 2 |
| β-strand | 350-353 | 4 | 7 |
| β-strand | 356-358 | 3 | 7 |
| β-strand | 363-364 | 2 | 2 |
| β-strand | 367 | 1 | 8 |
| α-helix | 414-422 | 9 | |
| β-strand | 427 | 1 | 8 |
| α-helix | 430-442 | 13 | |
| β-strand | 482-484 | 3 | 7 |
| β-strand | 485 | 1 | 1 |
| α-helix | 489-491 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Inducible nitric oxide synthase | A | protein | 388 | Mus musculus | P29477 (AlphaFold model) |
>2NOS_1 INDUCIBLE NITRIC OXIDE SYNTHASE (chains A) NPKSLTRGPRDKPTPLEELLPHAIEFINQYYGSFKEAKIEEHLARLEAVTKEIETTGTYQ LTLDELIFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYATNNGNI RSAITVFPQRSDGKHDFRLWNSQLIRYAGYQMPDGTIRGDAATLEFTQLCIDLGWKPRYG RFDVLPLVLQADGQDPEVFEIPPDLVLEVTMEHPKYEWFQELGLKWYALPAVANMLLEVG GLEFPACPFNGWYMGTEIGVRDFCDTQRYNILEEVGRRMGLETHTLASLWKDRAVTEINV AVLHSFQKQNVTIMDHHTASESFMKHMQNEYRARGGCPADWIWLVPPVSGSITPVFHQEM LNYVLSPFYYYQIEPWKTHIWQNEHHHH
Water and common crystallization additives (IMD) are not listed.
The structure of nitric oxide synthase oxygenase domain and inhibitor complexes. Crane, B.R., Arvai, A.S., Gachhui, R. et al. Science (1997) 278:425-431. DOI 10.1126/science.278.5337.425 · PubMed
Other PDB entries of the same protein (UniProt P29477 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2NOS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.