2NPT: PDB entry 2NPT

Crystal Structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (MAP2K5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (MAP3K2-phox). Determined by X-ray diffraction at 1.75 Å resolution. Released 28 Nov 2006.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,272
Mol. weight: 46.95 kDa
Released: 28 Nov 2006

Explore 2NPT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2NPT contains 18 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	17-23	7	1
β-strand	27-33	7	1
α-helix	34	1
α-helix	41-51	11
β-strand	59-63	5	2
β-strand	69-72	4	2
α-helix	75-93	19
α-helix	97-101	5
β-strand	102-104	3	1
β-strand	105-107	3	2

Chain B: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	43	1
β-strand	44-50	7	3
β-strand	53-59	7	3
α-helix	60	1
α-helix	63-64	2
α-helix	65-76	12
β-strand	80-86	7	3
β-strand	89-92	4	3
α-helix	96-108	13
β-strand	115-121	7	3

Chain C: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	6-9	4
β-strand	18-23	6	4
β-strand	27-32	6	4
α-helix	41-51	11
β-strand	59-63	5	3
β-strand	69-72	4	3
α-helix	75-94	20
α-helix	100-101	2
β-strand	102-104	3	4
β-strand	105-107	3	3

Chain D: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	42-43	2
β-strand	44-50	7	5
β-strand	53-59	7	5
α-helix	60	1
α-helix	63	1
α-helix	65-76	12
β-strand	80-86	7	5
β-strand	89-92	4	5
α-helix	96-108	13
β-strand	115-121	7	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dual specificity mitogen-activated protein kinase kinase 5	A, C	protein	106	Homo sapiens	Q13163 (AlphaFold model)
Mitogen-activated protein kinase kinase kinase 2	B, D	protein	100	Homo sapiens	Q9Y2U5 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>2NPT_1 Dual specificity mitogen-activated protein kinase kinase 5 (chains A, C)
SMALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEY
EDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRA

Sequence of entity 2 (B, D), FASTA

>2NPT_2 Mitogen-activated protein kinase kinase kinase 2 (chains B, D)
SMSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQFPRPVKLEDLRSKAKIAFGQSMDLH
YTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLVING

Primary citation

Crystal Structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (MAP2K5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (MAP3K2-phox). Filippakopoulos, P., Debreczeni, J., Papagrigoriou, V. et al. To be published.

Other PDB entries of the same protein (UniProt Q13163 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2O2V 1.83 Å, Crystal Structure of the Complex of Human Mitogen Activated Protein Kinase Kinase 5 Phox…
4IC7 2.6 Å, Crystal structure of the ERK5 kinase domain in complex with an MKK5 binding fragment

Browse structure collections

About this viewer

MolViewer shows 2NPT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.