Crystal structure of the C2 domain of the human E3 ubiquitin-protein ligase NEDD4-like protein. Determined by X-ray diffraction at 1.85 Å resolution. Released 19 Dec 2006.
Explore 2NSQ in 3D Show helices and sheets RCSB PDB PDBe
2NSQ contains 3 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-10 | 2 | 1 |
| β-strand | 20-30 | 11 | 1 |
| β-strand | 43-51 | 9 | 2 |
| β-strand | 56-62 | 7 | 2 |
| α-helix | 63-66 | 4 | |
| β-strand | 73-82 | 10 | 1 |
| β-strand | 87-95 | 9 | 2 |
| α-helix | 101-102 | 2 | |
| β-strand | 103-111 | 9 | 2 |
| β-strand | 117 | 1 | 1 |
| β-strand | 129-132 | 4 | 1 |
| α-helix | 133 | 1 | |
| β-strand | 134 | 1 | 2 |
| β-strand | 145-152 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase NEDD4-like protein | A | protein | 155 | Homo sapiens | Q96PU5 (AlphaFold model) |
>2NSQ_1 E3 ubiquitin-protein ligase NEDD4-like protein (chains A) GMATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELA LVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPTED PTMERPYTFKDFLLRPRSHKSRVKGFLRLKMAYMP
The C2 domain of the human E3 ubiquitin-protein ligase NEDD4-like protein. Walker, J.R., Avvakumov, G.V., Xue, S. et al. To be published.
Other PDB entries of the same protein (UniProt Q96PU5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2NSQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.