HECT domain of NEDD4-2 complex with a targeted nanobody, nb.C11. Determined by electron microscopy at 3.06 Å resolution. Released 17 Dec 2025.
Explore 9Z5Q in 3D Show helices and sheets RCSB PDB PDBe
9Z5Q contains 26 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-7 | 6 | 1 |
| β-strand | 12-13 | 2 | 2 |
| β-strand | 18-26 | 9 | 1 |
| β-strand | 31-39 | 9 | 3 |
| β-strand | 45-50 | 6 | 3 |
| β-strand | 58-59 | 2 | 3 |
| β-strand | 67-72 | 6 | 1 |
| β-strand | 77-82 | 6 | 1 |
| α-helix | 87-90 | 4 | |
| β-strand | 92-103 | 12 | 3 |
| β-strand | 105-112 | 8 | 3 |
| β-strand | 116-117 | 2 | 3 |
| β-strand | 120-121 | 2 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 549-551 | 3 | |
| β-strand | 554-558 | 5 | 4 |
| β-strand | 564-568 | 5 | 4 |
| β-strand | 573-575 | 3 | 4 |
| α-helix | 597-606 | 10 | |
| β-strand | 617-622 | 6 | 5 |
| α-helix | 624-626 | 3 | |
| α-helix | 627-636 | 10 | |
| α-helix | 641-644 | 4 | |
| β-strand | 647-652 | 6 | 5 |
| α-helix | 653-655 | 3 | |
| α-helix | 663-675 | 13 | |
| α-helix | 678-680 | 3 | |
| β-strand | 683-685 | 3 | 6 |
| β-strand | 693-695 | 3 | 6 |
| α-helix | 699-702 | 4 | |
| α-helix | 706-723 | 18 | |
| β-strand | 731 | 1 | 6 |
| α-helix | 733-740 | 8 | |
| α-helix | 742-744 | 3 | |
| α-helix | 749-752 | 4 | |
| α-helix | 754-765 | 12 | |
| β-strand | 774 | 1 | 7 |
| β-strand | 776-779 | 4 | 8 |
| β-strand | 786-789 | 4 | 8 |
| β-strand | 798 | 1 | 7 |
| α-helix | 804-812 | 9 | |
| α-helix | 813-817 | 5 | |
| α-helix | 818-832 | 15 | |
| α-helix | 837-840 | 4 | |
| α-helix | 845-853 | 9 | |
| α-helix | 856-858 | 3 | |
| α-helix | 860-865 | 6 | |
| β-strand | 867-870 | 4 | 9 |
| α-helix | 878-889 | 12 | |
| α-helix | 892-902 | 11 | |
| β-strand | 925-929 | 5 | 9 |
| α-helix | 936-937 | 2 | |
| β-strand | 938-940 | 3 | 9 |
| β-strand | 945-948 | 4 | 9 |
| α-helix | 954-966 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nanobody C11 (nb.C11) | A | protein | 162 | Lama glama | |
| E3 ubiquitin-protein ligase NEDD4-like | B | protein | 446 | Homo sapiens | Q96PU5 (AlphaFold model) |
>9Z5Q_1 Nanobody C11 (nb.C11) (chains A) MKYLLPTAAAGLLLLAAQPAMAMDIGINSDPQVQLQESGGGLVQAGGSLRLSCAASGNIS DVWYMGWYRQAPGKEREFVAGIAYGTSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPED TAVYYCAVIITRFVSYPRQHTYWGQGTQVTVSSPLEHHHHHH
>9Z5Q_2 E3 ubiquitin-protein ligase NEDD4-like (chains B) SYSLNPNDLGPLPPGWEERIHLDGRTFYIDHNSKITQWEDPRLQNPAITGPAVPYSREFK QKYDYFRKKLKKPADIPNRFEMKLHRNNIFEESYRRIMSVKRPDVLKARLWIEFESEKGL DYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAG LAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTELDLMFCID EENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPID LIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRL LQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLR EKLLMAVENAQGFEGVDMDYKDDDDK
Ion channel inhibition by targeted recruitment of NEDD4-2 with divalent nanobodies. Darko-Boateng, A., Afriyie, E., Morgenstern, T.J. et al. Nat Commun (2025) 17:378-378. DOI 10.1038/s41467-025-67068-x · PubMed
Other PDB entries of the same protein (UniProt Q96PU5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9Z5Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.