2NVQ: DNA-directed RNA polymerase II largest subunit

RNA Polymerase II Elongation Complex in 150 mM Mg+2 with 2'dUTP. Determined by X-ray diffraction at 2.9 Å resolution. Released 12 Dec 2006.

Method: X-ray diffraction
Resolution: 2.9 Å
Organisms: synthetic construct, Saccharomyces cerevisiae
Chains: 13
Atoms: 29,425
Mol. weight: 486.75 kDa
Ligands: MG, ZN, DUT
Released: 12 Dec 2006

Explore 2NVQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2NVQ contains 160 α-helices and 196 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 71 helices, 65 β-strands

Element	Residues	Length	Sheet
α-helix	10	1
β-strand	11	1	1
β-strand	16-18	3	2
α-helix	24-30	7
β-strand	67	1	3
β-strand	71	1	3
α-helix	80-81	2
β-strand	82-84	3	4
β-strand	90-91	2	5
α-helix	93-95	3
α-helix	96-103	8
β-strand	106	1	6
β-strand	113	1	6
α-helix	124-127	4
α-helix	133-142	10
β-strand	147	1	7
β-strand	152	1	8
β-strand	162	1	8
α-helix	169	1
β-strand	170	1	7
α-helix	171-172	2
β-strand	173-177	5	9
β-strand	180-184	5	9
β-strand	201	1	9
α-helix	204-213	10
α-helix	216-219	4
α-helix	220-222	3
β-strand	235-236	2	5
β-strand	239-241	3	4
α-helix	244-246	3
α-helix	265-271	7
α-helix	277-280	4
α-helix	289-297	9
α-helix	326-329	4
α-helix	335-339	5
β-strand	343-345	3	10
β-strand	348-355	8	11
β-strand	363-367	5	11
α-helix	368-371	4
β-strand	375-379	5	12
α-helix	385-394	10
β-strand	402-406	5	12
α-helix	426-427	2
β-strand	431-435	5	12
α-helix	436	1
β-strand	441-445	5	11
β-strand	455-463	9	11
β-strand	468-470	3	11
α-helix	472-474	3
α-helix	475-478	4
β-strand	486-490	5	11
α-helix	495-500	6
α-helix	501-505	5
β-strand	506	1	11
α-helix	508-510	3
β-strand	512-513	2	13
β-strand	518-519	2	13
α-helix	525-535	11
β-strand	540-542	3	14
α-helix	543-552	10
α-helix	560-563	4
β-strand	565	1	14
β-strand	571-573	3	14
α-helix	574-578	5
α-helix	579-581	3
β-strand	588-589	2	15
β-strand	606-608	3	15
β-strand	611-614	4	15
α-helix	619-622	4
α-helix	629-637	9
α-helix	639-660	22
α-helix	666-669	4
α-helix	673-698	26
α-helix	702-705	4
α-helix	710-736	27
α-helix	742-749	8
α-helix	755-762	8
β-strand	766-767	2	16
β-strand	770	1	17
β-strand	773	1	17
α-helix	775-776	2
β-strand	779	1	18
β-strand	782	1	18
α-helix	795-797	3
β-strand	799-800	2	16
α-helix	810-845	36
β-strand	849-850	2	19
β-strand	856-857	2	19
β-strand	863-865	3	19
α-helix	868-870	3
β-strand	873	1	20
β-strand	879-882	4	21
α-helix	890-897	8
α-helix	916-919	4
α-helix	926-944	19
β-strand	953-956	4	21
α-helix	960-970	11
α-helix	978-979	2
α-helix	983-993	11
α-helix	1005-1025	21
α-helix	1028-1033	6
α-helix	1039-1056	18
β-strand	1057	1	20
α-helix	1058-1059	2
α-helix	1064-1077	14
α-helix	1086-1088	3
α-helix	1097-1106	10
β-strand	1116-1119	4	22
β-strand	1120	1	23
α-helix	1128-1138	11
β-strand	1141-1142	2	24
β-strand	1147-1154	8	25
α-helix	1168-1171	4
β-strand	1191-1197	7	25
α-helix	1200-1202	3
α-helix	1209-1220	12
β-strand	1224-1228	5	25
β-strand	1237-1242	6	25
α-helix	1257-1269	13
β-strand	1272-1274	3	24
β-strand	1282-1287	6	22
β-strand	1290-1292	3	26
β-strand	1298-1300	3	26
β-strand	1303-1308	6	22
α-helix	1313-1316	4
β-strand	1322	1	23
β-strand	1328-1329	2	22
α-helix	1332-1359	28
α-helix	1365-1374	10
α-helix	1389-1391	3
α-helix	1396-1400	5
α-helix	1407-1414	8
β-strand	1418-1419	2	2
α-helix	1424-1429	6
α-helix	1437-1439	3
β-strand	1442-1444	3	27

Chain B: 50 helices, 74 β-strands

Element	Residues	Length	Sheet
α-helix	27-29	3
α-helix	30-34	5
α-helix	36-39	4
α-helix	45-53	9
α-helix	54-58	5
α-helix	59-63	5
β-strand	69	1	28
β-strand	90-97	8	28
β-strand	101-103	3	29
β-strand	109-111	3	29
α-helix	112	1
α-helix	114-119	6
β-strand	125-134	10	28
β-strand	165-171	7	28
α-helix	180-183	4
α-helix	186-191	6
β-strand	203-204	2	30
β-strand	209-210	2	30
β-strand	211	1	31
β-strand	214-218	5	32
β-strand	223-227	5	33
β-strand	234-242	9	33
β-strand	252-259	8	33
β-strand	269-272	4	33
β-strand	279-281	3	33
α-helix	282-289	8
α-helix	294-299	6
α-helix	308-320	13
α-helix	327-333	7
α-helix	347-358	12
α-helix	372-389	18
α-helix	394-396	3
α-helix	401-403	3
β-strand	404-407	4	32
α-helix	409-434	26
α-helix	451-462	12
α-helix	474-476	3
β-strand	481	1	31
α-helix	488-494	7
β-strand	497-499	3	32
α-helix	516-518	3
β-strand	522	1	34
β-strand	533	1	35
β-strand	536	1	35
β-strand	537-538	2	32
β-strand	539	1	34
β-strand	544-545	2	36
α-helix	552-558	7
β-strand	564-565	2	37
α-helix	566-568	3
α-helix	571-573	3
α-helix	577	1
β-strand	578-582	5	37
β-strand	585-590	6	37
α-helix	593-604	12
β-strand	614-618	5	37
β-strand	623-627	5	37
β-strand	633-639	7	36
β-strand	640-642	3	38
β-strand	649-651	3	38
α-helix	655-666	12
α-helix	681-686	6
β-strand	690-694	5	36
α-helix	695-698	4
β-strand	703-704	2	36
α-helix	728-730	3
β-strand	740-741	2	36
α-helix	745-748	4
α-helix	759-761	3
α-helix	764-773	10
α-helix	774-776	3
β-strand	777	1	39
β-strand	779	1	40
α-helix	783-787	5
β-strand	793-796	4	40
β-strand	800	1	41
β-strand	804-805	2	42
α-helix	807-811	5
β-strand	821-827	7	43
β-strand	838-842	5	43
α-helix	843-847	5
β-strand	853-862	10	40
β-strand	873-874	2	44
β-strand	898	1	45
β-strand	904-906	3	40
β-strand	910-912	3	45
β-strand	914-917	4	44
β-strand	934-936	3	44
β-strand	939-940	2	45
β-strand	946-956	11	40
β-strand	962-972	11	40
β-strand	979	1	43
β-strand	980-981	2	46
β-strand	989-994	6	43
α-helix	996-998	3
β-strand	1001-1002	2	47
β-strand	1010-1012	3	43
α-helix	1023-1038	16
β-strand	1042-1043	2	42
α-helix	1052-1061	10
β-strand	1072-1073	2	47
α-helix	1079	1
β-strand	1080	1	47
α-helix	1081	1
β-strand	1086-1092	7	43
β-strand	1093-1094	2	46
β-strand	1095	1	39
α-helix	1099-1101	3
β-strand	1104-1106	3	11
β-strand	1111	1	48
β-strand	1118	1	48
α-helix	1119	1
α-helix	1122-1124	3
β-strand	1128-1130	3	10
α-helix	1132-1141	10
α-helix	1144-1150	7
β-strand	1159-1163	5	1
β-strand	1174	1	49
β-strand	1179	1	49
β-strand	1182	1	50
β-strand	1187	1	50
β-strand	1191-1195	5	1
α-helix	1198-1209	12
β-strand	1215-1217	3	2

Chain C: 10 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	7-13	7	51
β-strand	17-23	7	51
α-helix	27-39	13
β-strand	43-54	12	52
α-helix	60-68	9
α-helix	77-79	3
β-strand	96-104	9	52
α-helix	110	1
β-strand	111-114	4	53
α-helix	115-117	3
β-strand	119-120	2	52
β-strand	143-147	5	53
β-strand	152-162	11	52
α-helix	168-170	3
β-strand	176-179	4	51
α-helix	197-200	4
α-helix	202-204	3
α-helix	205-207	3
β-strand	228-233	6	51
α-helix	240-264	25

Chain E: 12 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	4-26	23
β-strand	28	1	54
α-helix	32-35	4
α-helix	39-46	8
β-strand	47	1	55
β-strand	53	1	55
β-strand	61-62	2	56
β-strand	64	1	54
α-helix	66-71	6
β-strand	78-82	5	56
β-strand	88	1	57
α-helix	92-103	12
β-strand	107-112	6	56
β-strand	116	1	57
α-helix	120-123	4
β-strand	131-136	6	56
α-helix	137-140	4
α-helix	144-146	3
α-helix	151	1
β-strand	152-155	4	58
α-helix	158-167	10
α-helix	172-174	3
β-strand	177-178	2	59
α-helix	183-188	6
β-strand	196-202	7	58
β-strand	206-212	7	58
β-strand	213-214	2	59

Chain F: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	84	1	60
α-helix	85-86	2
α-helix	87-102	16
α-helix	117-126	10
β-strand	133-137	5	27
β-strand	143-147	5	27
β-strand	152	1	60

Chain H: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	6-16	11	14
β-strand	23-30	8	14
β-strand	37-43	7	14
β-strand	55-59	5	14
α-helix	78-81	4
α-helix	84-86	3
β-strand	96-98	3	14
β-strand	100-106	7	14
β-strand	112-118	7	14
β-strand	121-127	7	14
β-strand	141-145	5	14

Chain I: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	61
β-strand	13	1	61
β-strand	14-18	5	62
β-strand	25-29	5	62
β-strand	35-37	3	62
β-strand	42-45	4	25
α-helix	60-64	5
β-strand	70	1	63
α-helix	73-75	3
β-strand	83-87	5	63
β-strand	99-103	5	63
β-strand	109-111	3	63

Chain J: 5 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	3-4	2
α-helix	18-26	9
α-helix	32-38	7
α-helix	44-52	9
β-strand	53	1	41
α-helix	57-60	4

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-r(apupcpgpapgpapgpgpa)-3'	R	RNA	10	synthetic construct
28-MER DNA template strand	T	DNA	28	synthetic construct
5'-d(cptpgpcptptpaptpcpgpgptpapg)-3'	N	DNA	14	synthetic construct
DNA-directed RNA polymerase II largest subunit	A	protein	1733	Saccharomyces cerevisiae	P04050 (AlphaFold model)
DNA-directed RNA polymerase II 140 kDa polypeptide	B	protein	1224	Saccharomyces cerevisiae	P08518 (AlphaFold model)
DNA-directed RNA polymerase II 45 kDa polypeptide	C	protein	318	Saccharomyces cerevisiae	P16370 (AlphaFold model)
DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide	E	protein	215	Saccharomyces cerevisiae	P20434 (AlphaFold model)
DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide	F	protein	155	Saccharomyces cerevisiae	P20435
DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide	H	protein	146	Saccharomyces cerevisiae	P20436
DNA-directed RNA polymerase II subunit 9	I	protein	122	Saccharomyces cerevisiae	P27999
DNA-directed RNA polymerases I/II/III subunit 10	J	protein	70	Saccharomyces cerevisiae	P22139
DNA-directed RNA polymerase II 13.6 kDa polypeptide	K	protein	120	Saccharomyces cerevisiae	P38902

1 more molecules are not listed.

Sequence of entity 1 (R), FASTA

>2NVQ_1 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3' (chains R)
AUCGAGAGGA

Sequence of entity 2 (T), FASTA

>2NVQ_2 28-MER DNA template strand (chains T)
CTACCGATAAGCAGACGATCCTCTCGAT

Sequence of entity 3 (N), FASTA

>2NVQ_3 5'-D(*CP*TP*GP*CP*TP*TP*AP*TP*CP*GP*GP*TP*AP*G)-3' (chains N)
CTGCTTATCGGTAG

Sequence of entity 4 (A), FASTA

>2NVQ_4 DNA-directed RNA polymerase II largest subunit (chains A)
MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGS
IDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNE
LMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDGLK
LVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHV
ATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLE
LDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDSGDRIDLRYSKR
AGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTF
IELDQVLNMLYWVPDWDGVIPTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSP
KDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHN
GFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFV
DRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRR
LVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVD
LLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCC
LLRSRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMT
LNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEH
TTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHML
KKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVP
GIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGG
LTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGS
NDAMAGGFTAYGGADYGEATSPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTS
PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYS
PTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR

Sequence of entity 5 (B), FASTA

>2NVQ_5 DNA-directed RNA polymerase II 140 kDa polypeptide (chains B)
MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQ
DIICEDSTLILEQLAQHTTESDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLR
NLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDSESGKVFIGRLPIMLRSKNCY
LSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEH
ICYDVNDWQMLEMLKPCVEDGFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEF
LPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTL
FKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLS
LMSCISVGTDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETL
RTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIVEDDESLGHKELKVRKGHIAK
LMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGV
FLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMI
MNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRTNTLRMKHGTYDKLDDDGLIA
PGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSR
MTVAHLIECLLSKVAALSGNEGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKK
LMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIA
HGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF

Sequence of entity 6 (C), FASTA

>2NVQ_6 DNA-directed RNA polymerase II 45 kDa polypeptide (chains C)
MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD
EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI
VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY
DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY
SNASQMGNTGSGGYDNAW

Sequence of entity 7 (E), FASTA

>2NVQ_7 DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide (chains E)
MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSF
QANPTEESISKFPDMGSLWVEFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSA
MKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDEKRELLKRYRLKESQLPRIQR
ADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM

Sequence of entity 8 (F), FASTA

>2NVQ_8 DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide (chains F)
MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQ
HEQIRRKTLKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRI
AMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL

Sequence of entity 9 (H), FASTA

>2NVQ_9 DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide (chains H)
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIA
SSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGG
LLMRLEGNYRNLNNLKQENAYLLIRR

Sequence of entity 10 (I), FASTA

>2NVQ_10 DNA-directed RNA polymerase II subunit 9 (chains I)
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQ
DIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
FS

Sequence of entity 11 (J), FASTA

>2NVQ_11 DNA-directed RNA polymerases I/II/III subunit 10 (chains J)
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKF
LRYNPLEKRD

Sequence of entity 12 (K), FASTA

>2NVQ_12 DNA-directed RNA polymerase II 13.6 kDa polypeptide (chains K)
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA
YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
ZN	Zinc ion	Zn	8
DUT	Deoxyuridine-5'-triphosphate	C9 H15 N2 O14 P3	1

Primary citation

Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis. Wang, D., Bushnell, D.A., Westover, K.D. et al. Cell (2006) 127:941-954. DOI 10.1016/j.cell.2006.11.023 · PubMed

Other PDB entries of the same protein (UniProt P04050 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5VKO 1.8 Å, SPT6 tSH2-RPB1 1468-1500 pT1471, pS1493
9SV6 1.96 Å, CryoEM structure of transcribing RNA polymerase II elongation complex with ATP and Elf1
5VKL 2.2 Å, SPT6 tSH2-RPB1 1476-1500 pS1493
9W8V 2.23 Å, Structure of post-translocation state of yeast Pol II complexed with a cisplatin-induced…
9QEB 2.26 Å, CryoEM structure of transcribing RNA polymerase II elongation complex
1TWF 2.3 Å, RNA polymerase II complexed with UTP at 2.3 A resolution
9RYB 2.33 Å, CryoEM structure of transcribing RNA polymerase II elongation complex in post-catalysis…
9KD8 2.46 Å, The structure of RNA polymerase II elongation complex paused at N-2 state by actinomycin…
6NPW 2.49 Å, SSu72/Sympk in complex with Ser2/Ser5 phosphorylated peptide
9K7F 2.5 Å, RNA polymerase II elongation complex apo structure.
30ES 2.54 Å, Cryo-EM structure of the yeast RNA polymerase II elongation complex with 19-mer RNA in…
30EP 2.55 Å, Cryo-EM structure of the yeast RNA polymerase II elongation complex with 19-mer RNA in…

Browse structure collections

About this viewer

MolViewer shows 2NVQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.