2OAR: Mechanosensitive Channel of Large Conductance

Mechanosensitive Channel of Large Conductance (MscL). Determined by X-ray diffraction at 3.5 Å resolution. Released 9 Jan 2007.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: Mycobacterium tuberculosis H37Ra
Chains: 5
Atoms: 4,758
Mol. weight: 94.68 kDa
Ligands: AU
Released: 9 Jan 2007

Explore 2OAR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OAR contains 40 α-helices and 10 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	2-10	9
α-helix	13-34	22
α-helix	35-39	5
α-helix	40-46	7
β-strand	51-53	3	1
β-strand	65-67	3	1
α-helix	69-85	17
α-helix	86-91	6
α-helix	92-99	8
α-helix	106-123	18

Chain B: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	2-10	9
α-helix	13-34	22
α-helix	35-39	5
α-helix	40-46	7
β-strand	51-53	3	2
β-strand	65-67	3	2
α-helix	69-85	17
α-helix	86-91	6
α-helix	92-100	9
α-helix	106-124	19

Chains C and E: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	2-10	9
α-helix	13-34	22
α-helix	35-39	5
α-helix	40-46	7
β-strand	51-53	3	3
β-strand	65-67	3	3
α-helix	69-85	17
α-helix	86-91	6
α-helix	92-99	8
α-helix	106-124	19

Chain D: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	2-10	9
α-helix	13-34	22
α-helix	35-39	5
α-helix	40-46	7
β-strand	51-53	3	4
β-strand	65-67	3	4
α-helix	69-85	17
α-helix	86-91	6
α-helix	92-100	9
α-helix	106-123	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Large-conductance mechanosensitive channel	A, B, C, D, E	protein	174	Mycobacterium tuberculosis H37Ra	A5U127 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>2OAR_1 Large-conductance mechanosensitive channel (chains A, B, C, D, E)
MGHHHHHHHHHHSSGHIDDDDKHMLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDS
IITPLINRIGVNAQSDVGILRIGIGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTL
RKKGEVEQPGDTQVVLLTEIRDLLAQTNGDSPGRHGGRGTPSPTDGPRASTESQ

Ligands and cofactors

ID	Name	Formula	Copies
AU	Gold ion	Au	3

Primary citation

Structures of the Prokaryotic Mechanosensitive Channels MscL and MscS. Steinbacher, S., Bass, R., Strop, P. et al. Current Topics In Membranes (2007) 58. PubMed

Browse more

2OAR is part of these collections:

Ion channels

About this viewer

MolViewer shows 2OAR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.