2OC3: PDB entry 2OC3

Crystal Structure of the Catalytic Domain of Human Protein Tyrosine Phosphatase non-receptor Type 18. Determined by X-ray diffraction at 1.5 Å resolution. Released 30 Jan 2007.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,505
Mol. weight: 34.3 kDa
Released: 30 Jan 2007

Explore 2OC3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OC3 contains 14 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	11-14	4
α-helix	25-43	19
α-helix	49-52	4
α-helix	57-59	3
α-helix	69-71	3
β-strand	72-74	3	1
α-helix	79-81	3
β-strand	86-93	8	1
β-strand	99-104	6	1
α-helix	105-108	4
α-helix	109-111	3
α-helix	112-121	10
β-strand	126-129	4	1
β-strand	134-135	2	2
β-strand	138-139	2	2
β-strand	147	1	3
β-strand	150	1	3
β-strand	152-154	3	1
β-strand	157-168	12	1
β-strand	171-180	10	1
β-strand	183-192	10	1
α-helix	205-218	14
α-helix	223-224	2
β-strand	225-228	4	1
α-helix	234-250	17
α-helix	260-268	9
α-helix	278-292	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase non-receptor type 18	A	protein	303	Homo sapiens	Q99952 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2OC3_1 Tyrosine-protein phosphatase non-receptor type 18 (chains A)
GPLGSPGIPDSARSFLERLEARGGREGAVLAGEFSDIQACSAAWKADGVCSTVAGSRPEN
VRKNRYKDVLPYDQTRVILSLLQEEGHSDYINGNFIRGVDGSLAYIATQGPLPHTLLDFW
RLVWEFGVKVILMACREIENGRKRCERYWAQEQEPLQTGLFCITLIKEKWLNEDIMLRTL
KVTFQKESRSVYQLQYMSWPDRGVPSSPDHMLAMVEEARRLQGSGPEPLCVHCSAGCGRT
GVLCTVDYVRQLLLTQMIPPDFSLFDVVLKMRKQRPAAVQTEEQYRFLYHTVAQMFCSTL
QNA

Primary citation

Large-scale structural analysis of the classical human protein tyrosine phosphatome. Barr, A.J., Ugochukwu, E., Lee, W.H. et al. Cell (2009) 136:352-363. DOI 10.1016/j.cell.2008.11.038 · PubMed

Other PDB entries of the same protein (UniProt Q99952 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4GFU 2.0 Å, PTPN18 in complex with HER2-pY1248 phosphor-peptides
4GFV 2.1 Å, PTPN18 in complex with HER2-pY1196 phosphor-peptides
4NND 2.5 Å, Structural basis of PTPN18 fingerprint on distinct HER2 tyrosine phosphorylation sites

Browse structure collections

About this viewer

MolViewer shows 2OC3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.