2OCV: Na+ activation mimicry in murine thrombin

Structural basis of Na+ activation mimicry in murine thrombin. Determined by X-ray diffraction at 2.2 Å resolution. Released 10 Apr 2007.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Mus musculus
Chains: 2
Atoms: 2,535
Mol. weight: 36.14 kDa
Ligands: NAG
Released: 10 Apr 2007

Explore 2OCV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OCV contains 14 α-helices and 21 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	1J-1G	4
α-helix	8-10	3
α-helix	14C-14I	7

Chain B: 11 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
α-helix	22-23	2
β-strand	30-35	6	3
β-strand	39-46	8	3
β-strand	51-54	4	3
α-helix	56-59	4
β-strand	60-60A	2	4
α-helix	60B-60D	3
β-strand	60F-60G	2	4
β-strand	64-68	5	3
β-strand	72	1	5
β-strand	81-83	3	3
β-strand	85-90	6	3
β-strand	104-108	5	3
α-helix	111-114	4
α-helix	120-121	2
β-strand	122	1	2
α-helix	123-124	2
α-helix	126-129C	7
β-strand	135-140	6	2
β-strand	154	1	5
β-strand	156-162	7	2
α-helix	163-164	2
α-helix	165-171	7
β-strand	180-183	4	2
β-strand	189	1	1
β-strand	198-202	5	2
β-strand	207-215	9	2
β-strand	226-230	5	2
α-helix	232-234	3
α-helix	235-245	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thrombin	A	protein	42	Mus musculus	P19221 (AlphaFold model)
Thrombin	B	protein	259	Mus musculus	P19221 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2OCV_1 Thrombin (chains A)
TFFNEKTFGLGEADCGLRPLFEKKSLKDTTEKELLDSYIDGR

Sequence of entity 2 (B), FASTA

>2OCV_2 Thrombin (chains B)
IVEGWDAEKGIAPWQVMLFRKSPQELLCGASLISDRWVLTAAHCILYPPWDKNFTENDLL
VRIGKHSRTRYERNVEKISMLEKIYVHPRYNWRENLDRDIALLKLKKPVPFSDYIHPVCL
PDKQTVTSLLRAGYKGRVTGWGNLRETWTTNINEIQPSVLQVVNLPIVERPVCKASTRIR
ITDNMFCAGFKVNDTKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRKGKYGFY
THVFRLKAWIQKVIDQFGE

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4

Primary citation

Structural basis of na+ activation mimicry in murine thrombin. Marino, F., Chen, Z.W., Ergenekan, C.E. et al. J Biol Chem (2007) 282:16355-16361. DOI 10.1074/jbc.M701323200 · PubMed

Other PDB entries of the same protein (UniProt P19221 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HK3 1.94 Å, Crystal structure of murine thrombin mutant W215A/E217A (one molecule in the asymmetric…
2PUX 2.0 Å, Crystal structure of murine thrombin in complex with the extracellular fragment of…
3HKI 2.2 Å, Crystal structure of murine thrombin mutant W215A/E217A in complex with the…
3EDX 2.4 Å, Crystal structure of the W215A/E217A mutant of murine thrombin
3HK6 3.2 Å, Crystal structure of murine thrombin mutant W215A/E217A (two molecules in the asymmetric…
2PV9 3.5 Å, Crystal structure of murine thrombin in complex with the extracellular fragment of…

Browse structure collections

About this viewer

MolViewer shows 2OCV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.