Crystal structure of chloroplast FtsY from Arabidopsis thaliana. Determined by X-ray diffraction at 2.0 Å resolution. Released 11 Dec 2007.
Explore 2OG2 in 3D Show helices and sheets RCSB PDB PDBe
2OG2 contains 17 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 25-32 | 8 | |
| α-helix | 34-40 | 7 | |
| α-helix | 42-47 | 6 | |
| α-helix | 52-54 | 3 | |
| α-helix | 55-68 | 14 | |
| α-helix | 73-88 | 16 | |
| α-helix | 95-110 | 16 | |
| β-strand | 127-132 | 6 | 1 |
| α-helix | 139-152 | 14 | |
| β-strand | 157-160 | 4 | 1 |
| α-helix | 167-180 | 14 | |
| β-strand | 183-185 | 3 | 1 |
| α-helix | 194-207 | 14 | |
| β-strand | 212-216 | 5 | 1 |
| α-helix | 225-241 | 17 | |
| β-strand | 248-254 | 7 | 1 |
| α-helix | 255-261 | 7 | |
| α-helix | 262-271 | 10 | |
| β-strand | 276-280 | 5 | 1 |
| α-helix | 289-298 | 10 | |
| α-helix | 300-301 | 2 | |
| β-strand | 302-306 | 5 | 1 |
| α-helix | 311-313 | 3 | |
| β-strand | 314-316 | 3 | 1 |
| α-helix | 319-327 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Putative signal recognition particle receptor | A | protein | 359 | Arabidopsis thaliana | O80842 (AlphaFold model) |
>2OG2_1 Putative signal recognition particle receptor (chains A) GSGMKETAAAKFGERQHMDSPDLGTDDDDKAMACSAGPSGFFTRLGRLIKEKAKSDVEKV FSGFSKTRENLAVIDELLLFWNLAETDRVLDELEEALLVSDFGPKITVRIVERLREDIMS GKLKSGSEIKDALKESVLEMLAKKNSKTELQLGFRKPAVIMIVGVNGGGKTTSLGKLAHR LKNEGTKVLMAAGDTFRAAASDQLEIWAERTGCEIVVAEGDKAKAATVLSKAVKRGKEEG YDVVLCDTSGRLHTNYSLMEELIACKKAVGKIVSGAPNEILLVLDGNTGLNMLPQAREFN EVVGITGLILTKLDGSARGGCVVSVVEELGIPVKFIGVGEAVEDLQPFDPEAFVNAIFS
Structure of the Chloroplast Signal Recognition Particle (SRP) Receptor: Domain Arrangement Modulates SRP-Receptor Interaction. Chandrasekar, S., Chartron, J., Jaru-Ampornpan, P. et al. J Mol Biol (2007) 375:425-436. DOI 10.1016/j.jmb.2007.09.061 · PubMed
Other PDB entries of the same protein (UniProt O80842 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2OG2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.