Crystal structure of chloroplast FtsY from Arabidopsis thaliana in complex with the alarmone ppGpp. Determined by X-ray diffraction at 1.99 Å resolution. Released 1 Jan 2025.
Explore 8RIX in 3D Show helices and sheets RCSB PDB PDBe
8RIX contains 13 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 72-78 | 7 | |
| α-helix | 80-86 | 7 | |
| α-helix | 90-92 | 3 | |
| α-helix | 93-106 | 14 | |
| α-helix | 111-126 | 16 | |
| α-helix | 133-148 | 16 | |
| β-strand | 165-170 | 6 | 1 |
| α-helix | 177-189 | 13 | |
| β-strand | 195-200 | 6 | 1 |
| α-helix | 205-216 | 12 | |
| β-strand | 221-223 | 3 | 1 |
| α-helix | 232-245 | 14 | |
| β-strand | 250-255 | 6 | 1 |
| α-helix | 265-277 | 13 | |
| β-strand | 286-292 | 7 | 1 |
| α-helix | 300-309 | 10 | |
| β-strand | 314-318 | 5 | 1 |
| α-helix | 327-336 | 10 | |
| β-strand | 340-344 | 5 | 1 |
| β-strand | 352-354 | 3 | 1 |
| α-helix | 357-365 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cell division protein FtsY homolog, chloroplastic | A | protein | 314 | Arabidopsis thaliana | O80842 (AlphaFold model) |
>8RIX_1 Cell division protein FtsY homolog, chloroplastic (chains A) MGHHHHHHMGEKVFSGFSKTRENLAVIDELLLFWNLAETDRVLDELEEALLVSDFGPKIT VRIVERLREDIMSGKLKSGSEIKDALKESVLEMLAKKNSKTELQLGFRKPAVIMIVGVNG GGKTTSLGKLAHRLKNEGTKVLMAAGDTFRAAASDQLEIWAERTGCEIVVAEGDKAKAAT VLSKAVKRGKEEGYDVVLCDTSGRLHTNYSLMEELIACKKAVGKIVSGAPNEILLVLDGN TGLNMLPQAREFNEVVGITGLILTKLDGSARGGCVVSVVEELGIPVKFIGVGEAVEDLQP FDPEAFVNAIFSLE
Structure of chloroplast FtsY from Arabidopsis thaliana in complex with the alarmone ppGpp. Czech, L., Bange, G. To be published.
Other PDB entries of the same protein (UniProt O80842 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8RIX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.