2OGV: Autoinhibited Human c-Fms Kinase Domain

Crystal Structure of the Autoinhibited Human c-Fms Kinase Domain. Determined by X-ray diffraction at 2.7 Å resolution. Released 6 Feb 2007.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,559
Mol. weight: 35.79 kDa
Released: 6 Feb 2007

Explore 2OGV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OGV contains 20 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	551-552	2	1
β-strand	553-556	4	2
β-strand	561-563	3	2
α-helix	566-568	3
α-helix	573-575	3
β-strand	576	1	3
α-helix	579-581	3
β-strand	582-590	9	3
β-strand	594-602	9	3
β-strand	610-618	9	3
α-helix	629-638	10
β-strand	646	1	4
α-helix	647-648	2
β-strand	649-653	5	3
β-strand	660-664	5	3
β-strand	670	1	4
α-helix	671-679	9
α-helix	752-771	20
β-strand	774-775	2	1
α-helix	781-783	3
β-strand	784-786	3	4
α-helix	788-790	3
β-strand	792-794	3	4
α-helix	803-805	3
β-strand	810-812	3	5
β-strand	815-817	3	5
α-helix	819-821	3
α-helix	824-829	6
α-helix	834-849	16
α-helix	853-854	2
α-helix	865-870	6
α-helix	875-878	4
α-helix	883-892	10
α-helix	897-899	3
α-helix	903-914	12
α-helix	915-917	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Macrophage colony-stimulating factor 1 receptor precursor	A	protein	317	Homo sapiens	P07333 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2OGV_1 Macrophage colony-stimulating factor 1 receptor precursor (chains A)
KPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAF
GLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVI
TEYCCYGDLLNFLRRKAEADLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAA
RNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWSY
GILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRP
TFQQICSFLQEQAQEDR

Primary citation

The 2.7 A crystal structure of the autoinhibited human c-Fms kinase domain. Walter, M., Lucet, I.S., Patel, O. et al. J Mol Biol (2007) 367:839-847. DOI 10.1016/j.jmb.2007.01.036 · PubMed

Other PDB entries of the same protein (UniProt P07333 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8JOT 1.69 Å, Crystal structure of CSF-1R kinase domain with sulfatinib
6T2W 1.7 Å, Crystal structure of the CSF1R kinase domain with a dihydropurinone inhibitor (compound 4)
2I1M 1.8 Å, cFMS tyrosine kinase (tie2 KID) in complex with an arylamide inhibitor
6IG8 1.8 Å, Crystal structure of CSF-1R kinase domain with a small molecular inhibitor, JTE-952
2I0Y 1.9 Å, cFMS tyrosine kinase (FGF KID) in complex with an arylamide inhibitor
8CGC 1.93 Å, Structure of CSF1R in complex with a pyrollopyrimidine (compound 23)
3DPK 1.95 Å, cFMS tyrosine kinase in complex with a pyridopyrimidinone inhibitor
3BEA 2.02 Å, cFMS tyrosine kinase (tie2 KID) in complex with a pyrimidinopyridone inhibitor
3KRJ 2.1 Å, cFMS tyrosine kinase in complex with 4-Cyano-1H-imidazole-2-carboxylic acid…
6N33 2.25 Å, Crystal structure of fms kinase domain with a small molecular inhibitor, PLX5622
8W1L 2.26 Å, Structure of CSF1R kinase domain in complex with Cpd 32
3KRL 2.4 Å, cFMS Tyrosine kinase in complex with 5-Cyano-furan-2-carboxylic acid…

Browse structure collections

About this viewer

MolViewer shows 2OGV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.