Crystal structure of human RAB25 in complex with GDP. Determined by X-ray diffraction at 2.3 Å resolution. Released 23 Jan 2007.
Explore 2OIL in 3D Show helices and sheets RCSB PDB PDBe
2OIL contains 7 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11-18 | 8 | 1 |
| α-helix | 25-34 | 10 | |
| β-strand | 47-56 | 10 | 1 |
| β-strand | 59-68 | 10 | 1 |
| α-helix | 78-82 | 5 | |
| β-strand | 87-93 | 7 | 1 |
| α-helix | 97-101 | 5 | |
| α-helix | 103-111 | 9 | |
| β-strand | 119-125 | 7 | 1 |
| α-helix | 127-132 | 6 | |
| α-helix | 137-146 | 10 | |
| β-strand | 150-154 | 5 | 1 |
| α-helix | 162-178 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ras-related protein Rab-25 | A | protein | 193 | Homo sapiens | P57735 (AlphaFold model) |
>2OIL_1 Ras-related protein Rab-25 (chains A) MGSSHHHHHHSSGLVPRGSEDYNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGV EFSTRTVMLGTAAVKAQIWDTAGLERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWL KELYDHAEATIVVMLVGNKSDLSQAREVPTEEARMFAENNGLLFLETSALDSTNVELAFE TVLKEIFAKVSKQ
Water and common crystallization additives (UNX) are not listed.
Crystal structure of human RAB25 in complex with GDP. Zhu, H., Wang, J., Shen, Y. et al. To be published.
Other PDB entries of the same protein (UniProt P57735 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2OIL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.