3TSO: Cancer associated Rab25 protein

Structure of the cancer associated Rab25 protein in complex with FIP2. Determined by X-ray diffraction at 1.8 Å resolution. Released 19 Sept 2012.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,924
Mol. weight: 59.28 kDa
Ligands: PO4, GNP, MG
Released: 19 Sept 2012

Explore 3TSO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3TSO contains 20 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	11-18	8	1
α-helix	25-34	10
α-helix	42-45	4
β-strand	47-56	10	1
β-strand	59-68	10	1
α-helix	78-82	5
β-strand	87-93	7	1
α-helix	97-101	5
α-helix	103-111	9
β-strand	119-125	7	1
α-helix	127-132	6
α-helix	137-147	11
β-strand	150-153	4	1
α-helix	162-177	16

Chain B: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	12-18	7	2
α-helix	25-34	10
α-helix	41-45	5
β-strand	47-56	10	2
β-strand	59-68	10	2
α-helix	78-82	5
β-strand	87-93	7	2
α-helix	97-101	5
α-helix	103-113	11
β-strand	119-125	7	2
α-helix	130-132	3
α-helix	137-146	10
β-strand	150-153	4	2
α-helix	162-176	15

Chains C and D: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	453-491	39
α-helix	493-496	4
β-strand	497	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related protein Rab-25	A, B	protein	178	Homo sapiens	P57735 (AlphaFold model)
Rab11 family-interacting protein 2	C, D	protein	75	Homo sapiens	Q7L804 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3TSO_1 Ras-related protein Rab-25 (chains A, B)
GSHMEDYNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVK
AQIWDTAGLERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVML
VGNKSDLSQAREVPTEEARMFAENNGLLFLETSALDSTNVELAFETVLKEIFAKVSKQ

Sequence of entity 2 (C, D), FASTA

>3TSO_2 Rab11 family-interacting protein 2 (chains C, D)
SMNPFDATAGYRSLTYEEVLQELVKHKELLRRKDTHIRELEDYIDNLLVRVMEETPSILR
VPYEPSRKAGKFSNS

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	2
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	2
MG	Magnesium ion	Mg	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

Structure of the cancer associated Rab25 protein in complex with FIP2. Oda, S., Lall, P.Y., McCaffrey, M.W. et al. To be published.

Other PDB entries of the same protein (UniProt P57735 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OIL 2.3 Å, Crystal structure of human RAB25 in complex with GDP

Browse structure collections

About this viewer

MolViewer shows 3TSO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.