2OL6: OspA mutant

The crystal structure of OspA mutant. Determined by X-ray diffraction at 1.6 Å resolution. Released 11 Dec 2007.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Borrelia burgdorferi
Chains: 1
Atoms: 1,983
Mol. weight: 26.25 kDa
Released: 11 Dec 2007

Explore 2OL6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OL6 contains 4 α-helices and 23 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain O: 4 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	29-34	6	1
β-strand	38-43	6	1
β-strand	52-58	7	1
β-strand	61-67	7	1
β-strand	74-79	6	1
β-strand	85-90	6	1
β-strand	96-102	7	1
β-strand	109-116	8	1
β-strand	119-125	7	1
β-strand	131-137	7	1
β-strand	143-147	5	1
β-strand	155-161	7	1
β-strand	164-170	7	1
β-strand	174-181	8	1
β-strand	184-191	8	1
β-strand	196-202	7	1
β-strand	211-216	6	2
β-strand	221-226	6	2
β-strand	229-236	8	2
β-strand	242-246	5	2
β-strand	247	1	3
α-helix	248	1
β-strand	254	1	3
α-helix	258	1
β-strand	259-260	2	2
α-helix	261	1
α-helix	264-270	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer surface protein A	O	protein	250	Borrelia burgdorferi	P0CL66 (AlphaFold model)

Sequence of entity 1 (O), FASTA

>2OL6_1 Outer surface protein A (chains O)
GSHMKNSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKAD
ASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSNGSSTEEKFNEKGEVSEKIITRADGT
RLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELND
TDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEIT
KLDEIKNALK

Primary citation

beta-Strand Flipping and Slipping Triggered by Turn Replacement Reveal the Opportunistic Nature of beta-Strand Pairing. Makabe, K., Yan, S., Tereshko, V. et al. J Am Chem Soc (2007) 129:14661-14669. DOI 10.1021/ja074252c · PubMed

Other PDB entries of the same protein (UniProt P0CL66 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2I5V 1.1 Å, Crystal structure of OspA mutant
2G8C 1.15 Å, Atomic-resolution crystal structure of Borrelia burgdorferi OspA via surface entropy…
2I5Z 1.2 Å, The crystal structure of OspA mutant
6J48 1.2 Å, Glycine mutation on single layer beta-sheet of OspAsm1
9WVV 1.27 Å, The crystal structure of OspA mutant
2OYB 1.3 Å, The crystal structure of OspA mutant
2OL7 1.35 Å, The crystal structure of OspA mutant
6KWV 1.37 Å, A Crystal Structure of OspA mutant
2PI3 1.4 Å, The crystal structure of OspA mutant
6ICS 1.4 Å, Loop deletion mutant (deleting four residues)
6KT1 1.43 Å, Crystal structure of an OspA mutant
6KWU 1.43 Å, A Crystal Structure of OspA mutant

Browse structure collections

About this viewer

MolViewer shows 2OL6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.