2OM2: Human G[alpha]i1

Crystal Structure Of Human G[alpha]i1 Bound To The Goloco Motif Of Rgs14. Determined by X-ray diffraction at 2.2 Å resolution. Released 10 Jul 2007.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,039
Mol. weight: 83.44 kDa
Ligands: GDP, MG
Released: 10 Jul 2007

Explore 2OM2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OM2 contains 46 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	33-40	8	1
α-helix	46-57	12
α-helix	63-67	5
α-helix	70-90	21
α-helix	100-113	14
α-helix	115	1
α-helix	121-132	12
α-helix	134-140	7
α-helix	143-145	3
α-helix	152-157	6
α-helix	159-163	5
α-helix	171-176	6
β-strand	185-190	6	1
β-strand	195-200	6	1
α-helix	208-215	8
β-strand	220-226	7	1
α-helix	227-231	5
α-helix	232-235	4
α-helix	242-255	14
α-helix	257-259	3
β-strand	263-269	7	1
α-helix	271-277	7
α-helix	283-285	3
α-helix	296-308	13
β-strand	319-323	5	1
α-helix	329-346	18

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	498-508	11
α-helix	525-527	3
α-helix	528-530	3

Chain C: 19 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	1033-1039	7	2
α-helix	1048-1057	10
α-helix	1063-1068	6
α-helix	1070-1090	21
α-helix	1100-1113	14
β-strand	1115	1	3
β-strand	1118	1	3
α-helix	1121-1132	12
α-helix	1134-1140	7
α-helix	1143-1145	3
α-helix	1152-1156	5
α-helix	1159-1162	4
α-helix	1171-1175	5
β-strand	1185-1191	7	2
β-strand	1194-1200	7	2
α-helix	1208-1215	8
β-strand	1220-1225	6	2
α-helix	1228-1231	4
α-helix	1232-1235	4
α-helix	1242-1255	14
α-helix	1257-1259	3
β-strand	1263-1268	6	2
α-helix	1271-1277	7
α-helix	1283-1285	3
α-helix	1296-1308	13
β-strand	1319-1323	5	2
α-helix	1329-1345	17

Chain D: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	1497-1509	13
α-helix	1521-1524	4
α-helix	1525-1527	3
α-helix	1528-1530	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Guanine nucleotide-binding protein G(i), alpha-1 subunit	A, C	protein	325	Homo sapiens	P63096 (AlphaFold model)
Regulator of G-protein signalling 14 GoLoco motif peptide	B, D	protein	36		O43566 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>2OM2_1 Guanine nucleotide-binding protein G(i), alpha-1 subunit (chains A, C)
GAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMG
RLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLN
DSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERK
KWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLN
KKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDT
KNVQFVFDAVTDVIIKNNLKDCGLF

Sequence of entity 2 (B, D), FASTA

>2OM2_2 Regulator of G-protein signalling 14 GoLoco motif peptide (chains B, D)
DIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQ

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	2
MG	Magnesium ion	Mg	2

Primary citation

Structure-based Protocol for Identifying Mutations that Enhance Protein-Protein Binding Affinities. Sammond, D.W., Eletr, Z.M., Purbeck, C. et al. J Mol Biol (2007) 371:1392-1404. DOI 10.1016/j.jmb.2007.05.096 · PubMed

Other PDB entries of the same protein (UniProt P63096 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6CRK 2.0 Å, Heterotrimeric G-protein in complex with an antibody fragment
3UMR 2.04 Å, Crystal structure of the G202D mutant of human G-alpha-i1
9P7Z 2.1 Å, NTSR1-Gi-NTS(8-13) Complex in the Canonical, AHD Open State (C-Open-Apo)
8YN9 2.3 Å, Cryo-EM structure of histamine H4 receptor in complex with histamine and Gi
9HYI 2.3 Å, DP81-bound serotonin 5-HT1A receptor - Gi Protein Complex
9O36 2.3 Å, CryoEM structure of mu-opioid receptor - Gi protein complex bound to fluornitrazene (FNZ)
9P80 2.3 Å, NTSR1-Gi-NTS(8-13) Complex in the Non-Canonical, AHD Open State (NC-Open-Apo)
8XXV 2.33 Å, Cryo-EM Structure of the Prostaglandin D2 Receptor 2-indomethacin Coupled to G Protein
3UMS 2.34 Å, Crystal structure of the G202A mutant of human G-alpha-i1
3ONW 2.38 Å, Structure of a G-alpha-i1 mutant with enhanced affinity for the RGS14 GoLoco motif.
20ZG 2.4 Å, Cryo-EM structure of the human neurotensin receptor 1 (hNTSR1)-Gi1 complex in the…
20ZH 2.4 Å, Cryo-EM structure of the human neurotensin receptor 1 (hNTSR1)-Gi1 complex in the…

Browse structure collections

About this viewer

MolViewer shows 2OM2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.