Structure of a G-alpha-i1 mutant with enhanced affinity for the RGS14 GoLoco motif. Determined by X-ray diffraction at 2.38 Å resolution. Released 24 Nov 2010.
Explore 3ONW in 3D Show helices and sheets RCSB PDB PDBe
3ONW contains 42 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 33-40 | 8 | 1 |
| α-helix | 46-57 | 12 | |
| α-helix | 63-67 | 5 | |
| α-helix | 70-91 | 22 | |
| α-helix | 100-112 | 13 | |
| α-helix | 121-132 | 12 | |
| α-helix | 134-140 | 7 | |
| α-helix | 143-145 | 3 | |
| α-helix | 152-156 | 5 | |
| α-helix | 159-163 | 5 | |
| α-helix | 171-176 | 6 | |
| β-strand | 185-191 | 7 | 1 |
| β-strand | 194-200 | 7 | 1 |
| α-helix | 208-215 | 8 | |
| β-strand | 220-226 | 7 | 1 |
| α-helix | 227-231 | 5 | |
| α-helix | 232-235 | 4 | |
| α-helix | 242-255 | 14 | |
| α-helix | 257-259 | 3 | |
| β-strand | 263-269 | 7 | 1 |
| α-helix | 271-278 | 8 | |
| α-helix | 283-285 | 3 | |
| α-helix | 296-308 | 13 | |
| β-strand | 320-323 | 4 | 1 |
| α-helix | 329-345 | 17 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 33-40 | 8 | 2 |
| α-helix | 46-57 | 12 | |
| α-helix | 63-90 | 28 | |
| α-helix | 100-113 | 14 | |
| α-helix | 121-132 | 12 | |
| α-helix | 134-140 | 7 | |
| α-helix | 143-145 | 3 | |
| α-helix | 152-156 | 5 | |
| α-helix | 159-162 | 4 | |
| α-helix | 171-176 | 6 | |
| α-helix | 179-181 | 3 | |
| β-strand | 185-191 | 7 | 2 |
| β-strand | 194-200 | 7 | 2 |
| α-helix | 208-216 | 9 | |
| β-strand | 220-226 | 7 | 2 |
| α-helix | 227-231 | 5 | |
| α-helix | 242-255 | 14 | |
| α-helix | 257-259 | 3 | |
| β-strand | 263-269 | 7 | 2 |
| α-helix | 271-277 | 7 | |
| α-helix | 283-285 | 3 | |
| α-helix | 296-308 | 13 | |
| β-strand | 319-323 | 5 | 2 |
| α-helix | 329-344 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 498-509 | 12 | |
| α-helix | 521-524 | 4 | |
| α-helix | 525-527 | 3 | |
| α-helix | 528-530 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 497-509 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Guanine nucleotide-binding protein G(i) subunit alpha-1 | A, B | protein | 328 | Homo sapiens | P63096 (AlphaFold model) |
| Regulator of G-protein signaling 14 | C, D | protein | 36 | O43566 (AlphaFold model) |
>3ONW_1 Guanine nucleotide-binding protein G(i) subunit alpha-1 (chains A, B) SNAGAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIR AMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREY LLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRS ERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIIL FLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCA TDTKNVQFVFDAVTDVIIKNNLKDCGLF
>3ONW_2 Regulator of G-protein signaling 14 (chains C, D) DIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| GDP | Guanosine-5'-diphosphate | C10 H15 N5 O11 P2 | 2 |
Water and common crystallization additives (SO4) are not listed.
Structural Determinants of Affinity Enhancement between GoLoco Motifs and G-Protein {alpha} Subunit Mutants. Bosch, D.E., Kimple, A.J., Sammond, D.W. et al. J Biol Chem (2011) 286:3351-3358. DOI 10.1074/jbc.M110.190496 · PubMed
Other PDB entries of the same protein (UniProt P63096 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3ONW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.