2ONJ: Multidrug ABC transporter Sav1866 from S. aureus

Structure of the multidrug ABC transporter Sav1866 from S. aureus in complex with AMP-PNP. Determined by X-ray diffraction at 3.4 Å resolution. Released 13 Mar 2007.

Method: X-ray diffraction
Resolution: 3.4 Å
Organism: Staphylococcus aureus
Chains: 2
Atoms: 9,254
Mol. weight: 130.97 kDa
Ligands: ANP
Released: 13 Mar 2007

Explore 2ONJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ONJ contains 78 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 39 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	2-9	8
α-helix	10-12	3
α-helix	13-24	12
α-helix	32-38	7
α-helix	39-45	7
α-helix	52-68	17
α-helix	69-73	5
α-helix	74-104	31
α-helix	109-113	5
α-helix	117-122	6
α-helix	123-127	5
α-helix	128-130	3
α-helix	132-133	2
α-helix	134-141	8
α-helix	142-159	18
α-helix	164-167	4
α-helix	170-215	46
α-helix	219-272	54
α-helix	277-280	4
α-helix	282-285	4
α-helix	287-290	4
α-helix	293-318	26
α-helix	320-322	3
β-strand	340-347	8	1
β-strand	357-364	8	1
β-strand	369-373	5	2
α-helix	380-384	5
β-strand	397-400	4	1
β-strand	403-404	2	1
α-helix	405-407	3
α-helix	410-415	6
β-strand	417-420	4	2
β-strand	430	1	3
α-helix	431-435	5
α-helix	436-438	3
α-helix	444-454	11
α-helix	457-462	6
α-helix	466-468	3
α-helix	469	1
β-strand	470	1	3
α-helix	471-472	2
α-helix	473-475	3
α-helix	480-494	15
β-strand	498-502	5	2
α-helix	510-523	14
β-strand	528-532	5	2
α-helix	536-538	3
β-strand	544-549	6	2
β-strand	552-557	6	2
α-helix	559-565	7
α-helix	568-574	7

Chain B: 39 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	2-9	8
α-helix	10-12	3
α-helix	13-24	12
α-helix	32-40	9
α-helix	41-45	5
α-helix	55-58	4
α-helix	62-68	7
α-helix	69-73	5
α-helix	74-104	31
α-helix	109-113	5
α-helix	117-122	6
α-helix	123-127	5
α-helix	128-130	3
α-helix	132-133	2
α-helix	134-141	8
α-helix	142-159	18
α-helix	161-168	8
α-helix	170-215	46
α-helix	219-270	52
α-helix	279-285	7
α-helix	287-290	4
α-helix	293-318	26
α-helix	320-322	3
β-strand	340-347	8	4
β-strand	357-364	8	4
β-strand	369-373	5	5
α-helix	380-384	5
β-strand	397-400	4	4
β-strand	403-404	2	4
α-helix	405-407	3
α-helix	410-415	6
β-strand	417-420	4	5
β-strand	430	1	6
α-helix	431-435	5
α-helix	436-438	3
α-helix	444-454	11
α-helix	457-462	6
α-helix	466-468	3
α-helix	469	1
β-strand	470	1	6
α-helix	471-472	2
α-helix	473-475	3
α-helix	480-494	15
β-strand	498-502	5	5
α-helix	510-523	14
β-strand	528-532	5	5
α-helix	536-538	3
β-strand	544-549	6	5
β-strand	552-557	6	5
α-helix	559-565	7
α-helix	568-574	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Multidrug export ATP-binding/permease protein SAV1866	A, B	protein	578	Staphylococcus aureus	Q99T13 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2ONJ_1 Multidrug export ATP-binding/permease protein SAV1866 (chains A, B)
MIKRYLQFVKPYKYRIFATIIVGIIKFGIPMLIPLLIKYAIDGVINNHALTTDEKVHHLT
IAIGIALFIFVIVRPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQV
ISRVINDVEQTKDFILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYV
FFGRLRKLTRERSQALAEVQGFLHERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKH
TRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGSITVGTLAAFVGYLELLFGPLRRLVAS
FTTLTQSFASMDRVFQLIDEDYDIKNGVGAQPIEIKQGRIDIDHVSFQYNDNEAPILKDI
NLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLRNQIGLV
QQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSG
GQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTIT
HADKIVVIENGHIVETGTHRELIAKQGAYEHLYSIQNL

Ligands and cofactors

ID	Name	Formula	Copies
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	2

Water and common crystallization additives (NA) are not listed.

Primary citation

Structure of the multidrug ABC transporter Sav1866 from Staphylococcus aureus in complex with AMP-PNP. Dawson, R.J.P., Locher, K.P. FEBS Lett (2007) 581:935-938. DOI 10.1016/j.febslet.2007.01.073 · PubMed

Other PDB entries of the same protein (UniProt Q99T13 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HYD 3.0 Å, Multidrug ABC transporter SAV1866
4A82 9.0 Å, Fitted model of staphylococcus aureus sav1866 model ABC transporter in the human cystic…

Browse structure collections

About this viewer

MolViewer shows 2ONJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.