Murine inducible nitric oxide synthase oxygenase domain (delta 114) 2-[4-(2-Imidazol-1-yl-6-methyl-pyrimidin-4-yl)-1-isobutyryl-piperazin-2-yl]-N-[2-(4-methoxy-phenyl)-ethyl]-acetamide complex. Determined by X-ray diffraction at 1.97 Å resolution. Released 10 Apr 2007.
Explore 2ORP in 3D Show helices and sheets RCSB PDB PDBe
2ORP contains 20 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 116-118 | 3 | |
| β-strand | 120 | 1 | 1 |
| α-helix | 127-129 | 3 | |
| α-helix | 130-146 | 17 | |
| α-helix | 153-170 | 18 | |
| α-helix | 177-189 | 13 | |
| α-helix | 195-199 | 5 | |
| β-strand | 204-207 | 4 | 2 |
| α-helix | 214-229 | 16 | |
| α-helix | 230-232 | 3 | |
| β-strand | 237-240 | 4 | 2 |
| α-helix | 242-244 | 3 | |
| β-strand | 252-253 | 2 | 3 |
| β-strand | 257 | 1 | 2 |
| β-strand | 261 | 1 | 4 |
| β-strand | 263-265 | 3 | 5 |
| β-strand | 271-273 | 3 | 5 |
| α-helix | 275-277 | 3 | |
| α-helix | 278-286 | 9 | |
| α-helix | 297 | 1 | |
| β-strand | 298 | 1 | 4 |
| α-helix | 299-300 | 2 | |
| β-strand | 301-304 | 4 | 3 |
| α-helix | 308-310 | 3 | |
| β-strand | 311-313 | 3 | 3 |
| α-helix | 314-316 | 3 | |
| α-helix | 317-319 | 3 | |
| β-strand | 322-324 | 3 | 6 |
| α-helix | 325 | 1 | |
| β-strand | 339-341 | 3 | 6 |
| β-strand | 345-346 | 2 | 2 |
| β-strand | 350-353 | 4 | 7 |
| β-strand | 356-358 | 3 | 7 |
| β-strand | 363-364 | 2 | 2 |
| β-strand | 367 | 1 | 8 |
| α-helix | 417-422 | 6 | |
| β-strand | 427 | 1 | 8 |
| α-helix | 430-442 | 13 | |
| β-strand | 482-484 | 3 | 7 |
| β-strand | 485 | 1 | 1 |
| α-helix | 489-491 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| nitric oxide synthase, inducible | A | protein | 389 | Mus musculus | P29477 (AlphaFold model) |
>2ORP_1 nitric oxide synthase, inducible (chains A) MNPKSLTRGPRDKPTPLEELLPHAIEFINQYYGSFKEAKIEEHLARLEAVTKEIETTGTY QLTLDELIFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYATNNGN IRSAITVFPQRSDGKHDFRLWNSQLIRYAGYQMPDGTIRGDAATLEFTQLCIDLGWKPRY GRFDVLPLVLQADGQDPEVFEIPPDLVLEVTMEHPKYEWFQELGLKWYALPAVANMLLEV GGLEFPACPFNGWYMGTEIGVRDFCDTQRYNILEEVGRRMGLETHTLASLWKDRAVTEIN VAVLHSFQKQNVTIMDHHTASESFMKHMQNEYRARGGCPADWIWLVPPVSGSITPVFHQE MLNYVLSPFYYYQIEPWKTHIWQNEHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| R86 | 2-{(2R)-4-[2-(1H-imidazol-1-yl)-6-methylpyrimidin-4-yl]-1-isobutyrylpiperazin-2… | C27 H35 N7 O3 | 1 |
| HEM | Protoporphyrin IX containing FE | C34 H32 Fe N4 O4 | 1 |
Design, Synthesis, and Activity of 2-Imidazol-1-ylpyrimidine Derived Inducible Nitric Oxide Synthase Dimerization Inhibitors. Davey, D.D., Adler, M., Arnaiz, D. et al. J Med Chem (2007) 50:1146-1157. DOI 10.1021/jm061319i · PubMed
Other PDB entries of the same protein (UniProt P29477 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2ORP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.