2OV7: 50S ribosomal protein L1

Name: PDB 2OV7: The first domain of the ribosomal protein L1 from Thermus thermophilus
Published: 2007-12-25
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ribosomal protein

The first domain of the ribosomal protein L1 from Thermus thermophilus. Determined by X-ray diffraction at 2.3 Å resolution. Released 25 Dec 2007.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Thermus thermophilus
Chains: 3
Atoms: 3,228
Mol. weight: 45.51 kDa
Released: 25 Dec 2007

Explore 2OV7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OV7 contains 11 α-helices and 23 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	5-11	7
β-strand	20	1	1
α-helix	22-31	10
α-helix	39	1
β-strand	40-47	8	2
β-strand	59-63	5	3
β-strand	160-164	5	3
β-strand	170-177	8	2
α-helix	182-197	16
β-strand	209-216	8	2
β-strand	222-223	2	2
β-strand	224	1	1

Chain B: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	6-12	7
β-strand	20	1	4
α-helix	22-31	10
α-helix	39	1
β-strand	40-46	7	5
β-strand	59-63	5	6
β-strand	160-164	5	6
β-strand	170-177	8	5
α-helix	182-197	16
β-strand	212-215	4	5
α-helix	220-221	2
β-strand	222-223	2	5
β-strand	224	1	4

Chain C: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	20	1	7
α-helix	22-32	11
β-strand	40-47	8	7
β-strand	59-62	4	8
β-strand	161-164	4	8
β-strand	170-177	8	7
α-helix	182-196	15
β-strand	209-215	7	7
β-strand	221-224	4	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
50S ribosomal protein L1	A, B, C	protein	137	Thermus thermophilus	Q5SLP7 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>2OV7_1 50S ribosomal protein L1 (chains A, B, C)
PKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRG
TVSLPHGGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRS
VYVTTTMGPSVRINPHS

Primary citation

Domain I of ribosomal protein L1 is sufficient for specific RNA binding. Tishchenko, S., Nikonova, E., Kljashtorny, V. et al. Nucleic Acids Res (2007) 35:7389-7395. DOI 10.1093/nar/gkm898 · PubMed

Other PDB entries of the same protein (UniProt Q5SLP7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3TG8 1.95 Å, Mutant ribosomal protein L1 lacking ala158 from thermus thermophilus
2OUM 2.55 Å, The first domain of L1 from Thermus thermophilus
5NPM 2.7 Å, Crystal structure of mutant ribosomal protein TTHL1 lacking 8 N-terminal residues in…
4U26 2.8 Å, Crystal structure of the E. coli ribosome bound to dalfopristin and quinupristin.
4U27 2.8 Å, Crystal structure of the E. coli ribosome bound to flopristin and linopristin.
4V51 2.8 Å, Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and…
4WPO 2.8 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with elongation…
4WQF 2.8 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with elongation…
4WQU 2.8 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with elongation…
4WQY 2.8 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with elongation…
4V9H 2.86 Å, Crystal structure of the ribosome bound to elongation factor G in the guanosine…
4U20 2.9 Å, Crystal structure of the E. coli ribosome bound to flopristin.

Browse structure collections

About this viewer

MolViewer shows 2OV7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.