3TG8: 50S ribosomal protein L1

Name: PDB 3TG8: Mutant ribosomal protein L1 lacking ala158 from thermus thermophilus
Published: 2011-12-07
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ribosomal protein

Mutant ribosomal protein L1 lacking ala158 from thermus thermophilus. Determined by X-ray diffraction at 1.95 Å resolution. Released 7 Dec 2011.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Thermus thermophilus
Chains: 1
Atoms: 1,803
Mol. weight: 25.41 kDa
Released: 7 Dec 2011

Explore 3TG8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3TG8 contains 14 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	18-19	2
β-strand	20	1	1
α-helix	21	1
α-helix	22-31	10
α-helix	39	1
β-strand	40-47	8	2
α-helix	54-56	3
β-strand	59-63	5	3
α-helix	69-71	3
β-strand	74-77	4	4
α-helix	81-88	8
β-strand	93-95	3	4
α-helix	97-99	3
α-helix	100-104	5
β-strand	112-115	4	4
α-helix	117-119	3
α-helix	120-131	12
α-helix	140-142	3
β-strand	145	1	4
α-helix	149-156	8
β-strand	160-164	5	3
β-strand	170-177	8	2
α-helix	182-198	17
β-strand	209-216	8	2
β-strand	221-223	3	2
β-strand	224	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
50S ribosomal protein L1	A	protein	228	Thermus thermophilus	Q5SLP7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3TG8_1 50S ribosomal protein L1 (chains A)
MPKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVR
GTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDV
MGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKGRIEFRNDKTGAIHAPVGKASF
PPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS

Primary citation

Structural analysis of interdomain mobility in ribosomal L1 proteins. Tishchenko, S., Nikonova, E., Kostareva, O. et al. Acta Crystallogr D Biol Crystallogr (2011) 67:1023-1027. DOI 10.1107/S0907444911043435 · PubMed

Other PDB entries of the same protein (UniProt Q5SLP7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OV7 2.3 Å, The first domain of the ribosomal protein L1 from Thermus thermophilus
2OUM 2.55 Å, The first domain of L1 from Thermus thermophilus
5NPM 2.7 Å, Crystal structure of mutant ribosomal protein TTHL1 lacking 8 N-terminal residues in…
4U26 2.8 Å, Crystal structure of the E. coli ribosome bound to dalfopristin and quinupristin.
4U27 2.8 Å, Crystal structure of the E. coli ribosome bound to flopristin and linopristin.
4V51 2.8 Å, Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and…
4WPO 2.8 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with elongation…
4WQF 2.8 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with elongation…
4WQU 2.8 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with elongation…
4WQY 2.8 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with elongation…
4V9H 2.86 Å, Crystal structure of the ribosome bound to elongation factor G in the guanosine…
4U20 2.9 Å, Crystal structure of the E. coli ribosome bound to flopristin.

Browse structure collections

About this viewer

MolViewer shows 3TG8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.