Crystal structure of a coiled-coil tetramerization domain from Kv7.4 channels. Determined by X-ray diffraction at 2.07 Å resolution. Released 13 Mar 2007.
Explore 2OVC in 3D Show helices and sheets RCSB PDB PDBe
2OVC contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-30 | 26 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Potassium voltage-gated channel subfamily KQT member 4 | A | protein | 33 | Homo sapiens | P56696 (AlphaFold model) |
>2OVC_1 Potassium voltage-gated channel subfamily KQT member 4 (chains A) GAVDEISMMGRVVKVEKQVQSIEHKLDLLLGFY
Structural Insight into KCNQ (Kv7) Channel Assembly and Channelopathy. Howard, R.J., Clark, K.A., Holton, J.M. et al. Neuron (2007) 53:663-675. DOI 10.1016/j.neuron.2007.02.010 · PubMed
Other PDB entries of the same protein (UniProt P56696 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2OVC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.