2OY7: OspA mutant

The crystal structure of OspA mutant. Determined by X-ray diffraction at 1.55 Å resolution. Released 4 Mar 2008.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Borrelia burgdorferi
Chains: 1
Atoms: 2,832
Mol. weight: 34.67 kDa
Released: 4 Mar 2008

Explore 2OY7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OY7 contains 3 α-helices and 29 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	29-33	5	1
α-helix	35-37	3
β-strand	39-43	5	1
β-strand	52-58	7	1
β-strand	61-67	7	1
β-strand	74-79	6	1
β-strand	85-90	6	1
β-strand	96-102	7	1
β-strand	109-116	8	1
β-strand	121-126	6	1
β-strand	132-138	7	1
β-strand	144-149	6	1
β-strand	155-161	7	1
β-strand	167-172	6	1
β-strand	178-184	7	1
β-strand	190-195	6	1
β-strand	201-207	7	1
β-strand	213-217	5	1
β-strand	225-231	7	1
β-strand	234-240	7	1
β-strand	244-251	8	1
β-strand	254-261	8	1
β-strand	266-272	7	1
β-strand	281-286	6	2
β-strand	291-296	6	2
β-strand	299-306	8	2
β-strand	312-316	5	2
β-strand	317	1	3
α-helix	318	1
β-strand	324	1	3
β-strand	329-330	2	2
α-helix	334-341	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer surface protein A	A	protein	320	Borrelia burgdorferi	P0CL66 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2OY7_1 Outer surface protein A (chains A)
GSHMKNSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKAD
ASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKSSTYEKFNEKGELSEKYITRADK
SSTYEKFNEKGELSEKYITRADKSSTYEKFNEKGELSEKYITRADKSSTYEKFNEKGEVS
EKYITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISK
SGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGT
SLEGSAVEITKLDEIKNALK

Primary citation

Aromatic cross-strand ladders control the structure and stability of beta-rich peptide self-assembly mimics. Biancalana, M., Makabe, K., Koide, A. et al. J Mol Biol (2008) 383:205-213. DOI 10.1016/j.jmb.2008.08.031 · PubMed

Other PDB entries of the same protein (UniProt P0CL66 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2I5V 1.1 Å, Crystal structure of OspA mutant
2G8C 1.15 Å, Atomic-resolution crystal structure of Borrelia burgdorferi OspA via surface entropy…
2I5Z 1.2 Å, The crystal structure of OspA mutant
6J48 1.2 Å, Glycine mutation on single layer beta-sheet of OspAsm1
9WVV 1.27 Å, The crystal structure of OspA mutant
2OYB 1.3 Å, The crystal structure of OspA mutant
2OL7 1.35 Å, The crystal structure of OspA mutant
6KWV 1.37 Å, A Crystal Structure of OspA mutant
2PI3 1.4 Å, The crystal structure of OspA mutant
6ICS 1.4 Å, Loop deletion mutant (deleting four residues)
6KT1 1.43 Å, Crystal structure of an OspA mutant
6KWU 1.43 Å, A Crystal Structure of OspA mutant

Browse structure collections

About this viewer

MolViewer shows 2OY7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.