2OZ0: Cytochrome b2

Mechanistic and Structural Studies of H373Q Flavocytochrome b2: Effects of Mutating the Active Site Base. Determined by X-ray diffraction at 2.8 Å resolution. Released 11 Sept 2007.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 7,042
Mol. weight: 114.93 kDa
Ligands: HEM, FMN, PYR
Released: 11 Sept 2007

Explore 2OZ0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OZ0 contains 48 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	26-29	4	1
β-strand	32-35	4	1
α-helix	40-42	3
α-helix	48-50	3
α-helix	59-62	4
α-helix	63-65	3
α-helix	71-74	4
β-strand	80-83	4	1
α-helix	107-115	9
α-helix	117-118	2
α-helix	119-121	3
α-helix	125-135	11
α-helix	138-145	8
α-helix	152-159	8
α-helix	160-163	4
β-strand	165-166	2	2
β-strand	178	1	3
β-strand	181-183	3	4
β-strand	186-188	3	4
β-strand	192-194	3	5
α-helix	200-202	3
α-helix	209-218	10
β-strand	225-227	3	5
α-helix	228	1
α-helix	235-239	5
β-strand	249-253	5	5
α-helix	259-271	13
β-strand	276-280	5	5
α-helix	290-296	7
α-helix	332-340	9
β-strand	346-351	6	5
α-helix	354-363	10
β-strand	367-370	4	5
α-helix	381-383	3
α-helix	384-396	13
β-strand	405-409	5	5
α-helix	415-424	10
β-strand	429-431	3	5
α-helix	433-464	32
β-strand	469	1	3
α-helix	470-472	3
α-helix	475-477	3
β-strand	478-479	2	2
α-helix	480-482	3
β-strand	486-487	2	6
α-helix	494-499	6

Chain B: 20 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	108-115	8
α-helix	125-133	9
α-helix	138-145	8
β-strand	148	1	7
α-helix	152-159	8
α-helix	160-163	4
β-strand	165-166	2	8
β-strand	178	1	9
β-strand	181-183	3	10
β-strand	186-188	3	10
β-strand	192-194	3	11
α-helix	200-202	3
α-helix	209-217	9
β-strand	225-228	4	11
α-helix	235-239	5
β-strand	250-253	4	11
α-helix	259-272	14
β-strand	276-279	4	11
β-strand	289	1	7
α-helix	290-296	7
α-helix	319-321	3
α-helix	332-340	9
β-strand	346-351	6	11
α-helix	355-362	8
β-strand	367-370	4	11
β-strand	381	1	2
α-helix	382-383	2
α-helix	384-391	8
β-strand	405-409	5	11
α-helix	415-424	10
β-strand	428-431	4	11
α-helix	433-465	33
β-strand	469	1	9
α-helix	470-472	3
α-helix	475-477	3
β-strand	478-479	2	8
β-strand	488-489	2	6
α-helix	494-499	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cytochrome b2	A, B	protein	511	Saccharomyces cerevisiae	P00175 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2OZ0_1 Cytochrome b2 (chains A, B)
EPKLDMNKQKISPAEVAKHNKPDDCWVVINGYVYDLTRFLPNHPGGQDVIKFNAGKDVTA
IFEPLHAPNVIDKYIAPEKKLGPLQGSMPPELVCPPYAPGETKEDIARKEQLKSLLPPLD
NIINLYDFEYLASQTLTKQAWAYYSSGANDEVTHRENHNAYHRIFFKPKILVDVRKVDIS
TDMLGSHVDVPFYVSATALCKLGNPLEGEKDVARGCGQGVTKVPQMISTLASCSPEEIIE
AAPSDKQIQWYQLYVNSDRKITDDLVKNVEKLGVKALFVTVDAPSLGQREKDMKLKFSNT
KAGPKAMKKTNVEESQGASRALSKFIDPSLTWKDIEELKKKTKLPIVIKGVQRTEDVIKA
AEIGVSGVVLSNQGGRQLDFSRAPIEVLAETMPILEQRNLKDKLEVFVDGGVRRGTDVLK
ALCLGAKGVGLGRPFLYANSCYGRNGVEKAIEILRDEIEMSMRLLGVTSIAELKPDLLDL
STLKARTVGVPNDVLYNEVYEGPTLTEFEDA

Ligands and cofactors

ID	Name	Formula	Copies
HEM	Protoporphyrin IX containing FE	C34 H32 Fe N4 O4	1
FMN	Flavin mononucleotide	C17 H21 N4 O9 P	2
PYR	Pyruvic acid	C3 H4 O3	1

Primary citation

Mechanistic and structural studies of H373Q flavocytochrome b2: effects of mutating the active site base. Tsai, C.L., Gokulan, K., Sobrado, P. et al. Biochemistry (2007) 46:7844-7851. DOI 10.1021/bi7005543 · PubMed

Other PDB entries of the same protein (UniProt P00175 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1KBI 2.3 Å, Crystallographic Study of the Recombinant Flavin-binding Domain of Baker's Yeast…
1FCB 2.4 Å, Molecular structure of flavocytochrome B2 at 2.4 Å resolution
1KBJ 2.5 Å, Crystallographic Study of the Recombinant Flavin-binding Domain of Baker's Yeast…
1LTD 2.6 Å, The 2.6 Å refined structure of the escherichia coli recombinant saccharomyces cerevisiae…
1SZF 2.7 Å, A198G:L230A mutant flavocytochrome b2 with pyruvate bound
1SZG 2.7 Å, A198G:L230A flavocytochrome b2 with sulfite bound
3KS0 2.7 Å, Crystal structure of the heme domain of flavocytochrome b2 in complex with Fab B2B4
1QCW 2.75 Å, Flavocytochrome B2, ARG289LYS mutant
1LCO 2.9 Å, X-ray structure of two complexes of the Y143F flavocytochrome B2 mutant crystallized in…
1LDC 2.9 Å, X-ray structure of two complexes of the Y143F flavocytochrome B2 mutant crystallized in…
1SZE 3.0 Å, L230A mutant flavocytochrome b2 with benzoylformate
9J9B 3.83 Å, Substrate-engaged TIM23 complex from yeast

Browse structure collections

About this viewer

MolViewer shows 2OZ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.