Mechanistic and Structural Studies of H373Q Flavocytochrome b2: Effects of Mutating the Active Site Base. Determined by X-ray diffraction at 2.8 Å resolution. Released 11 Sept 2007.
Explore 2OZ0 in 3D Show helices and sheets RCSB PDB PDBe
2OZ0 contains 48 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 26-29 | 4 | 1 |
| β-strand | 32-35 | 4 | 1 |
| α-helix | 40-42 | 3 | |
| α-helix | 48-50 | 3 | |
| α-helix | 59-62 | 4 | |
| α-helix | 63-65 | 3 | |
| α-helix | 71-74 | 4 | |
| β-strand | 80-83 | 4 | 1 |
| α-helix | 107-115 | 9 | |
| α-helix | 117-118 | 2 | |
| α-helix | 119-121 | 3 | |
| α-helix | 125-135 | 11 | |
| α-helix | 138-145 | 8 | |
| α-helix | 152-159 | 8 | |
| α-helix | 160-163 | 4 | |
| β-strand | 165-166 | 2 | 2 |
| β-strand | 178 | 1 | 3 |
| β-strand | 181-183 | 3 | 4 |
| β-strand | 186-188 | 3 | 4 |
| β-strand | 192-194 | 3 | 5 |
| α-helix | 200-202 | 3 | |
| α-helix | 209-218 | 10 | |
| β-strand | 225-227 | 3 | 5 |
| α-helix | 228 | 1 | |
| α-helix | 235-239 | 5 | |
| β-strand | 249-253 | 5 | 5 |
| α-helix | 259-271 | 13 | |
| β-strand | 276-280 | 5 | 5 |
| α-helix | 290-296 | 7 | |
| α-helix | 332-340 | 9 | |
| β-strand | 346-351 | 6 | 5 |
| α-helix | 354-363 | 10 | |
| β-strand | 367-370 | 4 | 5 |
| α-helix | 381-383 | 3 | |
| α-helix | 384-396 | 13 | |
| β-strand | 405-409 | 5 | 5 |
| α-helix | 415-424 | 10 | |
| β-strand | 429-431 | 3 | 5 |
| α-helix | 433-464 | 32 | |
| β-strand | 469 | 1 | 3 |
| α-helix | 470-472 | 3 | |
| α-helix | 475-477 | 3 | |
| β-strand | 478-479 | 2 | 2 |
| α-helix | 480-482 | 3 | |
| β-strand | 486-487 | 2 | 6 |
| α-helix | 494-499 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 108-115 | 8 | |
| α-helix | 125-133 | 9 | |
| α-helix | 138-145 | 8 | |
| β-strand | 148 | 1 | 7 |
| α-helix | 152-159 | 8 | |
| α-helix | 160-163 | 4 | |
| β-strand | 165-166 | 2 | 8 |
| β-strand | 178 | 1 | 9 |
| β-strand | 181-183 | 3 | 10 |
| β-strand | 186-188 | 3 | 10 |
| β-strand | 192-194 | 3 | 11 |
| α-helix | 200-202 | 3 | |
| α-helix | 209-217 | 9 | |
| β-strand | 225-228 | 4 | 11 |
| α-helix | 235-239 | 5 | |
| β-strand | 250-253 | 4 | 11 |
| α-helix | 259-272 | 14 | |
| β-strand | 276-279 | 4 | 11 |
| β-strand | 289 | 1 | 7 |
| α-helix | 290-296 | 7 | |
| α-helix | 319-321 | 3 | |
| α-helix | 332-340 | 9 | |
| β-strand | 346-351 | 6 | 11 |
| α-helix | 355-362 | 8 | |
| β-strand | 367-370 | 4 | 11 |
| β-strand | 381 | 1 | 2 |
| α-helix | 382-383 | 2 | |
| α-helix | 384-391 | 8 | |
| β-strand | 405-409 | 5 | 11 |
| α-helix | 415-424 | 10 | |
| β-strand | 428-431 | 4 | 11 |
| α-helix | 433-465 | 33 | |
| β-strand | 469 | 1 | 9 |
| α-helix | 470-472 | 3 | |
| α-helix | 475-477 | 3 | |
| β-strand | 478-479 | 2 | 8 |
| β-strand | 488-489 | 2 | 6 |
| α-helix | 494-499 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytochrome b2 | A, B | protein | 511 | Saccharomyces cerevisiae | P00175 (AlphaFold model) |
>2OZ0_1 Cytochrome b2 (chains A, B) EPKLDMNKQKISPAEVAKHNKPDDCWVVINGYVYDLTRFLPNHPGGQDVIKFNAGKDVTA IFEPLHAPNVIDKYIAPEKKLGPLQGSMPPELVCPPYAPGETKEDIARKEQLKSLLPPLD NIINLYDFEYLASQTLTKQAWAYYSSGANDEVTHRENHNAYHRIFFKPKILVDVRKVDIS TDMLGSHVDVPFYVSATALCKLGNPLEGEKDVARGCGQGVTKVPQMISTLASCSPEEIIE AAPSDKQIQWYQLYVNSDRKITDDLVKNVEKLGVKALFVTVDAPSLGQREKDMKLKFSNT KAGPKAMKKTNVEESQGASRALSKFIDPSLTWKDIEELKKKTKLPIVIKGVQRTEDVIKA AEIGVSGVVLSNQGGRQLDFSRAPIEVLAETMPILEQRNLKDKLEVFVDGGVRRGTDVLK ALCLGAKGVGLGRPFLYANSCYGRNGVEKAIEILRDEIEMSMRLLGVTSIAELKPDLLDL STLKARTVGVPNDVLYNEVYEGPTLTEFEDA
| ID | Name | Formula | Copies |
|---|---|---|---|
| HEM | Protoporphyrin IX containing FE | C34 H32 Fe N4 O4 | 1 |
| FMN | Flavin mononucleotide | C17 H21 N4 O9 P | 2 |
| PYR | Pyruvic acid | C3 H4 O3 | 1 |
Mechanistic and structural studies of H373Q flavocytochrome b2: effects of mutating the active site base. Tsai, C.L., Gokulan, K., Sobrado, P. et al. Biochemistry (2007) 46:7844-7851. DOI 10.1021/bi7005543 · PubMed
Other PDB entries of the same protein (UniProt P00175 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2OZ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.