2P1Y: 1.B2.D9, a bispecific alpha/beta TCR

1.B2.D9, a bispecific alpha/beta TCR. Determined by X-ray diffraction at 2.42 Å resolution. Released 5 Feb 2008.

Method: X-ray diffraction
Resolution: 2.42 Å
Organism: Mus musculus
Chains: 4
Atoms: 7,017
Mol. weight: 105.07 kDa
Released: 5 Feb 2008

Explore 2P1Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2P1Y contains 14 α-helices and 92 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-14	5	2
β-strand	19-21	3	3
β-strand	22-25	4	1
β-strand	31-38	8	2
β-strand	42-49	8	2
β-strand	56-57	2	2
β-strand	66-68	3	3
β-strand	74	1	1
β-strand	76-79	4	3
α-helix	84-86	3
β-strand	88-95	8	2
β-strand	105-107	3	2
β-strand	111-116	6	2
α-helix	117	1
α-helix	204-214	11
β-strand	304-306	3	4
β-strand	309-313	5	5
β-strand	314	1	6
β-strand	316	1	6
β-strand	318-323	6	4
β-strand	331-337	7	5
β-strand	344-350	7	5
β-strand	355-358	4	4
β-strand	362-367	6	4
β-strand	372-377	6	4
α-helix	382-384	3
β-strand	386-394	9	5
β-strand	399-402	4	5
β-strand	406-411	6	5

Chain C: 4 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	7
β-strand	10-14	5	8
β-strand	19-25	7	7
β-strand	31-38	8	8
β-strand	42-49	8	8
β-strand	56-57	2	8
β-strand	66-68	3	7
β-strand	74-79	6	7
α-helix	84-86	3
β-strand	88-95	8	8
β-strand	105-107	3	8
β-strand	111-116	6	8
α-helix	203-214	12
β-strand	304-306	3	9
β-strand	309-313	5	10
α-helix	317	1
β-strand	318-323	6	9
β-strand	331-337	7	10
β-strand	344-350	7	10
β-strand	355-358	4	9
β-strand	362-367	6	9
β-strand	372-377	6	9
α-helix	382-384	3
β-strand	386-394	9	10
β-strand	399-402	4	10
β-strand	406-411	6	10

Chain E: 3 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	11
β-strand	10-14	5	12
β-strand	19-25	7	11
β-strand	31-38	8	12
β-strand	42-49	8	12
β-strand	56-57	2	12
β-strand	66-71	6	11
β-strand	74-79	6	11
α-helix	84-86	3
β-strand	88-95	8	12
β-strand	106-107	2	12
β-strand	111-116	6	12
β-strand	303-306	4	13
β-strand	309-313	5	14
α-helix	317	1
β-strand	318-324	7	13
β-strand	331-337	7	14
β-strand	344-350	7	14
β-strand	355-358	4	13
β-strand	362-367	6	13
β-strand	372-377	6	13
α-helix	382-384	3
β-strand	386-394	9	14
β-strand	399-402	4	14
β-strand	406-411	6	14

Chain G: 3 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	15
β-strand	10-13	4	16
β-strand	19-25	7	15
β-strand	31-38	8	16
β-strand	42-49	8	16
β-strand	56-57	2	16
β-strand	66-68	3	15
β-strand	74-79	6	15
α-helix	84-86	3
β-strand	88-95	8	16
β-strand	106-107	2	16
β-strand	111-115	5	16
β-strand	303-306	4	17
β-strand	309-313	5	18
α-helix	317	1
β-strand	318-324	7	17
β-strand	331-337	7	18
β-strand	344-350	7	18
β-strand	355-358	4	17
β-strand	362-367	6	17
β-strand	372-377	6	17
α-helix	382-384	3
β-strand	386-394	9	18
β-strand	399-402	4	18
β-strand	406-411	6	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
bispecific alpha/beta TCR	A, C, E, G	protein	238	Mus musculus	Q5R1B3 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>2P1Y_1 bispecific alpha/beta TCR (chains A, C, E, G)
MAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIP
DGYKASRPSQENFSLILELATPSQTSVYFCASGDLGQTNERLFFGHGTKLSVLGSADDAK
KDAAKKDGQVRQSPQSLTVWEGETAILNCSYENSAFDYFPWYQQFPGEGPALLISILSVS
DKKEDGRFTIFFNKREKKLSLHIADSQPGDSATYFCAAIDTNAYKVIFGKGTHLHVLP

Primary citation

A new twist in TCR diversity revealed by a forbidden alphabeta TCR. McBeth, C., Seamons, A., Pizarro, J.C. et al. J Mol Biol (2008) 375:1306-1319. DOI 10.1016/j.jmb.2007.11.020 · PubMed

Other PDB entries of the same protein (UniProt Q5R1B3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1U3H 2.42 Å, Crystal structure of mouse TCR 172.10 complexed with MHC class II I-Au molecule at 2.4 A
1B88 2.5 Å, V-alpha 2.6 mouse T cell receptor (TCR) domain

Browse structure collections

About this viewer

MolViewer shows 2P1Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.