2P4E: PCSK9

Crystal Structure of PCSK9. Determined by X-ray diffraction at 1.98 Å resolution. Released 10 Apr 2007.

Method: X-ray diffraction
Resolution: 1.98 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,776
Mol. weight: 149.32 kDa
Ligands: HG
Released: 10 Apr 2007

Explore 2P4E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2P4E contains 22 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 40 β-strands

Element	Residues	Length	Sheet
α-helix	156-160	5
β-strand	181-186	6	3
β-strand	200-206	7	3
α-helix	209-211	3
α-helix	220-223	4
α-helix	225-235	11
β-strand	246-251	6	3
β-strand	258-260	3	2
α-helix	261-277	17
β-strand	283-287	5	3
β-strand	289-290	2	2
β-strand	291-292	2	4
α-helix	295-306	12
α-helix	309	1
β-strand	310-314	5	3
β-strand	318	1	5
β-strand	321	1	6
α-helix	322-324	3
β-strand	325-326	2	4
β-strand	334-339	6	3
β-strand	345	1	3
α-helix	346	1
β-strand	347-348	2	5
β-strand	351-352	2	5
β-strand	355	1	6
β-strand	361-364	4	3
β-strand	368-371	4	7
β-strand	379-382	4	7
α-helix	385-402	18
α-helix	408-418	11
β-strand	420-421	2	3
α-helix	426-428	3
α-helix	431-433	3
β-strand	440-441	2	3
α-helix	444-446	3
β-strand	456-461	6	8
α-helix	462-464	3
β-strand	472-475	4	9
β-strand	482-489	8	8
β-strand	495-496	2	9
β-strand	497	1	10
β-strand	498-502	5	9
β-strand	507-513	7	9
β-strand	521-528	8	8
β-strand	533-539	7	10
β-strand	548-551	4	11
β-strand	557-565	9	10
β-strand	587-590	4	11
β-strand	595-602	8	10
β-strand	606-616	11	12
β-strand	621-625	5	8
α-helix	626-627	2
β-strand	631-637	7	12
β-strand	644-650	7	8
β-strand	653-658	6	8
α-helix	670	1
β-strand	671-681	11	12

Chain P: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	63-65	3	1
α-helix	70-72	3
β-strand	73-82	10	1
α-helix	83	1
α-helix	88-104	17
β-strand	110-115	6	1
β-strand	121-125	5	1
α-helix	128-130	3
α-helix	131-135	5
β-strand	140-147	8	1
β-strand	148-151	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proprotein convertase subtilisin/kexin type 9	A, P	protein	692	Homo sapiens	Q8NBP7 (AlphaFold model)

Sequence of entity 1 (A, P), FASTA

>2P4E_1 Proprotein convertase subtilisin/kexin type 9 (chains A, P)
MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLAEAPEHGT
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLP
GFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLERITPPRYRADEYQPPDGGSLV
EVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAG
VAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAA
CQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVD
LFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSA
KDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAIARCAPD
EELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAP
PAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASC
CHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRD
VSTTGSTSEEAVTAVAICCRSRHLAQASQELQ

Ligands and cofactors

ID	Name	Formula	Copies
HG	Mercury (II) ion	Hg	2

Primary citation

Structural and biophysical studies of PCSK9 and its mutants linked to familial hypercholesterolemia. Cunningham, D., Danley, D.E., Geoghegan, K.F. et al. Nat Struct Mol Biol (2007) 14:413-419. DOI 10.1038/nsmb1235 · PubMed

Other PDB entries of the same protein (UniProt Q8NBP7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7S5H 1.27 Å, PCSK9(deltaCRD) in complex with cyclic peptide 35
6XIC 1.38 Å, PCSK9(deltaCRD) in complex with cyclic peptide 40
6XIE 1.43 Å, PCSK9(deltaCRD) in complex with cyclic peptide 77
9HZ3 1.43 Å, PCSK9 AZD0780 complex
6XID 1.48 Å, PCSK9(deltaCRD) in complex with cyclic peptide 51
6U26 1.53 Å, PCSK9 in complex with compound 16
6XIB 1.55 Å, PCSK9(deltaCRD) in complex with cyclic peptide 30
9SZY 1.76 Å, PCSK9 CTD fragment structure
6XIF 1.77 Å, PCSK9(deltaCRD) in complex with cyclic peptide 83
10SB 1.83 Å, PCSK9 in complex with cyclic peptide 21
4NMX 1.85 Å, PCSK9(deltaCRD) in complex with phage-derived inhibitory peptide 2-8
2QTW 1.9 Å, The Crystal Structure of PCSK9 at 1.9 Angstroms Resolution Reveals structural homology…

Browse structure collections

About this viewer

MolViewer shows 2P4E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.