2PCF: Plastocyanin

The complex of cytochrome F and plastocyanin determined with paramagnetic NMR. Based on the structures of cytochrome F and plastocyanin, 10 structures. Determined by solution NMR. Released 8 Apr 1998.

Method: Solution NMR
Organisms: Spinacia oleracea, Brassica rapa
Chains: 2
Atoms: 2,702
Mol. weight: 38.42 kDa
Ligands: CU, HEC
Released: 8 Apr 1998

Explore 2PCF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2PCF contains 9 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	19-21	3	2
β-strand	27	1	3
β-strand	28-31	4	1
β-strand	39-41	3	4
α-helix	52-55	4
β-strand	69	1	1
β-strand	72	1	3
β-strand	78-79	2	2
β-strand	82-84	3	4
α-helix	85-87	3
β-strand	93-94	2	4
β-strand	96-98	3	2

Chain B: 7 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	2-8	7
β-strand	13	1	5
β-strand	19	1	5
α-helix	20-23	4
β-strand	28	1	6
β-strand	32-34	3	7
β-strand	38-39	2	6
β-strand	44-50	7	7
β-strand	59-60	2	8
β-strand	66-67	2	8
β-strand	70-76	7	6
α-helix	77-78	2
β-strand	82-83	2	7
α-helix	84-85	2
α-helix	86-88	3
α-helix	91-94	4
β-strand	103-106	4	6
β-strand	109-119	11	6
β-strand	125-131	7	7
α-helix	135-137	3
β-strand	145-154	10	6
β-strand	159	1	9
β-strand	165	1	9
β-strand	172	1	10
β-strand	177-184	8	11
β-strand	190-196	7	11
β-strand	201-207	7	11
β-strand	213	1	12
β-strand	220-221	2	11
β-strand	226	1	10
β-strand	228	1	12
β-strand	235-245	11	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Plastocyanin	A	protein	99	Spinacia oleracea	P00289 (AlphaFold model)
Cytochrome F	B	protein	250	Brassica rapa	P36438 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2PCF_1 PLASTOCYANIN (chains A)
VEVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEE
DLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN

Sequence of entity 2 (B), FASTA

>2PCF_2 CYTOCHROME F (chains B)
YPIFAQQNYENPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVVKIPYDMQLKQV
LANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPNKKNILVIGPVPG
QKYSEITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIIS
KILRKEKGGYEITIVDASNERQVIDIIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQGD
AEIVLQDPLR

Ligands and cofactors

ID	Name	Formula	Copies
CU	Copper (II) ion	Cu	1
HEC	Heme C	C34 H36 Fe N4 O4	1

Primary citation

The structure of the complex of plastocyanin and cytochrome f, determined by paramagnetic NMR and restrained rigid-body molecular dynamics. Ubbink, M., Ejdeback, M., Karlsson, B.G. et al. Structure (1998) 6:323-335. DOI 10.1016/S0969-2126(98)00035-5 · PubMed

Other PDB entries of the same protein (UniProt P00289 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1AG6 1.6 Å, Plastocyanin from spinach
1TEF 1.9 Å, Crystal structure of the spinach plastocyanin mutants G8D/K30C/T69C and K30C/T69C- a…
1TEG 1.96 Å, Crystal structure of the spinach plastocyanin mutants G8D/K30C/T69C and K30C/T69C- a…
1OOW 2.0 Å, The crystal structure of the spinach plastocyanin double mutant G8D/L12E gives insight…
9TGG 3.18 Å, Cryo-EM structure of Spinacia oleracea cytochrome b6f complex with bound plastocyanin
1YLB NMR solution structure of the reduced spinach plastocyanin

Browse structure collections

About this viewer

MolViewer shows 2PCF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.