2PLV: Human poliovirus type 1

Name: PDB 2PLV: Structural factors that control conformational transitions and serotype specificity in type 3 poliovirus
Published: 1989-10-17
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: virus

Structural factors that control conformational transitions and serotype specificity in type 3 poliovirus. Determined by X-ray diffraction at 2.88 Å resolution. Released 17 Oct 1989.

Method: X-ray diffraction
Resolution: 2.88 Å
Organism: Human poliovirus 1
Chains: 4
Atoms: 7,162
Mol. weight: 97.92 kDa
Ligands: MYR, SPH
Released: 17 Oct 1989

Explore 2PLV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2PLV contains 29 α-helices and 64 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 1: 10 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	8-9	2	1
β-strand	22	1	2
β-strand	26	1	3
α-helix	27-29	3
β-strand	30	1	4
β-strand	44-45	2	5
α-helix	47-49	3
α-helix	57-59	3
α-helix	63-65	3
β-strand	66	1	4
β-strand	71	1	3
α-helix	73-75	3
β-strand	76	1	6
α-helix	77-81	5
β-strand	85-94	10	7
β-strand	106-109	4	8
α-helix	117-122	6
β-strand	125-142	18	7
β-strand	154-160	7	8
α-helix	173-176	4
β-strand	182-186	5	8
β-strand	192-196	5	7
β-strand	205-206	2	7
β-strand	211	1	9
β-strand	217	1	10
α-helix	222-225	4
β-strand	239-244	6	8
β-strand	253-271	19	7
α-helix	295-296	2
β-strand	297	1	11

Chain 2: 10 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	14-18	5	12
β-strand	21-25	5	12
β-strand	28-33	6	13
α-helix	34-36	3
β-strand	54	1	13
α-helix	57-59	3
β-strand	64-65	2	13
α-helix	66-68	3
β-strand	69-72	4	14
β-strand	78-82	5	15
α-helix	84-86	3
α-helix	90-98	9
β-strand	99-111	13	13
β-strand	118-128	11	15
α-helix	131-133	3
β-strand	134	1	16
α-helix	145-148	4
α-helix	151-153	3
β-strand	155-156	2	15
β-strand	158	1	17
β-strand	174	1	16
β-strand	177	1	17
α-helix	178-180	3
α-helix	187-192	6
β-strand	195-199	5	15
β-strand	205-210	6	13
β-strand	219	1	13
β-strand	224	1	9
β-strand	227-239	13	15
β-strand	246-249	4	14
β-strand	250-263	14	13
β-strand	269	1	10

Chain 3: 5 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	23	1	7
β-strand	39-40	2	7
β-strand	42	1	6
α-helix	43-47	5
β-strand	51-52	2	5
β-strand	57	1	11
α-helix	65-68	4
β-strand	70-73	4	5
β-strand	83-86	4	18
α-helix	99-104	6
β-strand	107-111	5	19
β-strand	114-120	7	5
β-strand	127	1	20
β-strand	129-135	7	18
α-helix	145-149	5
β-strand	152-157	6	18
β-strand	163-168	6	5
β-strand	177-178	2	19
α-helix	183-185	3
β-strand	189-194	6	18
β-strand	199	1	20
β-strand	207-216	10	5
β-strand	221-225	5	19

Chain 4: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	26-29	4	1
α-helix	36-38	3
α-helix	45	1
β-strand	46	1	2
α-helix	47	1
α-helix	51-54	4
β-strand	57	1	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human poliovirus type 1 (subunit VP1)	1	protein	302	Human poliovirus 1	P03300 (AlphaFold model)
Human poliovirus type 1 (subunit VP2)	2	protein	272	Human poliovirus 1	P03300 (AlphaFold model)
Human poliovirus type 1 (subunit VP3)	3	protein	238	Human poliovirus 1	P03300 (AlphaFold model)
Human poliovirus type 1 (subunit VP4)	4	protein	68	Human poliovirus 1	P03300 (AlphaFold model)

Sequence of entity 1 (1), FASTA

>2PLV_1 HUMAN POLIOVIRUS TYPE 1 (SUBUNIT VP1) (chains 1)
GLGQMLESMIDNTVSSTVGAATSRDALPNTEASGPTHSKEIPALTAVETGATNPLVPSDT
VQTRHVVQHRSRSESSIESFFARGACVTIMTVDNPASTTNKDKLFAVWKITYKDTVQLRR
KLEFFTYSRFDMELTFVVTANFTETNNGHALNQVYQIMYVPPGAPVPEKWDDYTWQTSSN
PSIFYTYGTAPARISVPYVGISNAYSHFYDGFSKVPLKDQSAALGDSLYGAASLNDFGIL
AVRVVNDHNPTKVTSKIRVYLKPKHIRVWCPRPPRAVAYYGPGVDYKDGTLTPLSTKDLT
TY

Sequence of entity 2 (2), FASTA

>2PLV_2 HUMAN POLIOVIRUS TYPE 1 (SUBUNIT VP2) (chains 2)
SPNIEACGYSDRVLQLTLGNSTITTQEAANSVVAYGRWPEYLRDSEANPVDQPTEPDVAA
CRFYTLDTVSWTKESRGWWWKLPDALRDMGLFGQNMYYHYLGRSGYTVHVQCNASKFHQG
ALGVFAVPEMCLAGDSNTTTMHTSYQNANPGEKGGTFTGTFTPDNNQTSPARRFCPVDYL
LGNGTLLGNAFVFPHQIINLRTNNCATLVLPYVNSLSIDSMVKHNNWGIAILPLAPLNFA
SESSPEIPITLTIAPMCCEFNGLRNITLPRLQ

Sequence of entity 3 (3), FASTA

>2PLV_3 HUMAN POLIOVIRUS TYPE 1 (SUBUNIT VP3) (chains 3)
GLPVMNTPGSNQYLTADNFQSPCALPEFDVTPPIDIPGEVKNMMELAEIDTMIPFDLSAT
KKNTMEMYRVRLSDKPHTDDPILCLSLSPASDPRLSHTMLGEILNYYTHWAGSLKFTFLF
CGSMMATGKLLVSYAPPGADPPKKRKEAMLGTHVIWDIGLQSSCTMVVPWISNTTYRQTI
DDSFTEGGYISVFYQTRIVVPLSTPREMDILGFVSACNDFSVRLLRDTTHIEQKALAQ

Sequence of entity 4 (4), FASTA

>2PLV_4 HUMAN POLIOVIRUS TYPE 1 (SUBUNIT VP4) (chains 4)
GAQVSSQKVGAHENSNRAYGGSTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVL
IKTAPMLN

Ligands and cofactors

ID	Name	Formula	Copies
MYR	Myristic acid	C14 H28 O2	1
SPH	Sphingosine	C18 H37 N O2	1

Primary citation

Structural factors that control conformational transitions and serotype specificity in type 3 poliovirus. Filman, D.J., Syed, R., Chow, M. et al. EMBO J (1989) 8:1567-1579. PubMed

Other PDB entries of the same protein (UniProt P03300 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DCD 1.69 Å, 1.6A resolution structure of PolioVirus 3C Protease Containing a covalently bound…
9U04 1.7 Å, LX-2D6 (Fab) - Polio 1 (VLP) complex
1RA6 2.0 Å, Poliovirus Polymerase Full Length Apo Structure
4NLR 2.0 Å, Poliovirus Polymerase - C290S Loop Mutant
4NLS 2.0 Å, Poliovirus Polymerase - S288A Loop Mutant
1L1N 2.1 Å, Poliovirus 3C proteinase
4NLU 2.1 Å, Poliovirus Polymerase - G289A Loop Mutant
4NLW 2.1 Å, Poliovirus Polymerase - G289A/C290I Loop Mutant
1HXS 2.2 Å, Crystal structure of mahoney strain of poliovirus at 2.2A resolution
4NLO 2.2 Å, Poliovirus Polymerase - C290I Loop Mutant
4NLP 2.2 Å, Poliovirus Polymerase - C290V Loop Mutant
2IM0 2.25 Å, Crystal structure of poliovirus polymerase complexed with CTP and Mg2+

Browse more

2PLV is part of these collections:

Viruses

About this viewer

MolViewer shows 2PLV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.