2POI: XIAP BIR1 domain

Crystal structure of XIAP BIR1 domain (I222 form). Determined by X-ray diffraction at 1.8 Å resolution. Released 3 Jul 2007.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 704
Mol. weight: 10.56 kDa
Ligands: ZN
Released: 3 Jul 2007

Explore 2POI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2POI contains 4 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	26-30	5
α-helix	31-33	3
α-helix	44-49	6
β-strand	52-54	3	1
β-strand	61-63	3	1
β-strand	69-70	2	1
α-helix	79-86	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Baculoviral IAP repeat-containing protein 4	A	protein	94	Homo sapiens	P98170 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2POI_1 Baculoviral IAP repeat-containing protein 4 (chains A)
GSHMKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFS
CHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLE

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

XIAP Induces NF-kappaB Activation via the BIR1/TAB1 Interaction and BIR1 Dimerization. Lu, M., Lin, S.C., Huang, Y. et al. Mol Cell (2007) 26:689-702. DOI 10.1016/j.molcel.2007.05.006 · PubMed

Other PDB entries of the same protein (UniProt P98170 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4J44 1.3 Å, Crystal structure of XIAP-BIR2 domain with AIAV bound
8W59 1.34 Å, Crystal structure of the RING domain of human XIAP treated with arsenic trioxide
4J47 1.35 Å, Crystal structure of XIAP-BIR2 domain with SVPI bound
4J46 1.42 Å, Crystal structure of XIAP-BIR2 domain with AVPI bound
4J3Y 1.45 Å, Crystal structure of XIAP-BIR2 domain
4J45 1.48 Å, Crystal structure of XIAP-BIR2 domain with ATAA bound
5O6T 1.57 Å, BIRC4 RING in complex with dimeric ubiquitin variant
4KJU 1.6 Å, Crystal structure of XIAP-Bir2 with a bound benzodiazepinone inhibitor.
8W5A 1.65 Å, Crystal structure of the RING domain of human XIAP
4KJV 1.7 Å, Crystal structure of XIAP-Bir2 with a bound spirocyclic benzoxazepinone inhibitor.
3UW5 1.71 Å, Crystal structure of the BIR domain of MLIAP bound to GDC0152
8GH7 1.75 Å, 142D6 bound to BIR3-XIAP

Browse structure collections

About this viewer

MolViewer shows 2POI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.