2PRU: Human apoS100B at 10C

NMR Structure of Human apoS100B at 10C. Determined by solution NMR. Released 15 Apr 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,482
Mol. weight: 21.19 kDa
Released: 15 Apr 2008

Explore 2PRU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2PRU contains 8 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	2-16	15
β-strand	27	1	1
α-helix	29-38	10
α-helix	49-63	15
β-strand	68	1	1
α-helix	70-81	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein S100-B	A, B	protein	91	Homo sapiens	P04271 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2PRU_1 Protein S100-B (chains A, B)
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETL
DNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Primary citation

Analysis of the structure of human apo-S100B at low temperature indicates a unimodal conformational distribution is adopted by calcium-free S100 proteins. Malik, S., Revington, M., Smith, S.P. et al. Proteins (2008) 73:28-42. DOI 10.1002/prot.22037 · PubMed

Other PDB entries of the same protein (UniProt P04271 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5D7F 1.3 Å, X-ray structure of Ca(2+)-S100B with human RAGE-derived W72 peptide
3CZT 1.4 Å, Crystal Structure of S100B in the Calcium and Zinc Loaded State at pH 9
3D0Y 1.5 Å, Crystal Structure of S100B in the Calcium and Zinc Loaded State at pH 6.5
3D10 1.65 Å, Crystal Structure of S100B in the Calcium and Zinc Loaded State at pH 10.0
2H61 1.9 Å, X-ray structure of human Ca2+-loaded S100B
3HCM 2.0 Å, Crystal structure of human S100B in complex with S45
5CSI 2.13 Å, S100B-RSK1 crystal structure A'
5CSF 2.4 Å, S100B-RSK1 crystal structure A
4XYN 2.55 Å, X-ray structure of Ca(2+)-S100B with human RAGE-derived W61 peptide
5CSJ 2.7 Å, S100B-RSK1 crystal structure B
5CSN 2.95 Å, S100B-RSK1 crystal structure C
1MQ1 Ca2+-S100B-TRTK-12 complex

Browse structure collections

About this viewer

MolViewer shows 2PRU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.