2Q3G: PDZ domain of human PDLIM7

Structure of the PDZ domain of human PDLIM7 bound to a C-terminal extension from human beta-tropomyosin. Determined by X-ray diffraction at 1.11 Å resolution. Released 19 Jun 2007.

Method: X-ray diffraction
Resolution: 1.11 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,689
Mol. weight: 18.83 kDa
Released: 19 Jun 2007

Explore 2Q3G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Q3G contains 7 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	1-9	9	1
β-strand	16-19	4	1
β-strand	29-33	5	1
α-helix	38-41	4
β-strand	49-53	5	1
β-strand	56-57	2	1
α-helix	58-60	3
α-helix	63-71	9
β-strand	76-84	9	1

Chain B: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	2-9	8	2
α-helix	13	1
β-strand	16-19	4	2
β-strand	29-33	5	2
α-helix	38-41	4
β-strand	49-53	5	2
β-strand	56-57	2	2
α-helix	58-60	3
α-helix	63-71	9
β-strand	76-83	8	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PDZ and LIM domain protein 7	A, B	protein	89	Homo sapiens	Q9NR12 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2Q3G_1 PDZ and LIM domain protein 7 (chains A, B)
SMDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAG
SLTHIEAQNKIRACGERLSLGLSRAITSL

Primary citation

Unusual binding interactions in PDZ domain crystal structures help explain binding mechanisms. Elkins, J.M., Gileadi, C., Shrestha, L. et al. Protein Sci (2010) 19:731-741. DOI 10.1002/pro.349 · PubMed

Other PDB entries of the same protein (UniProt Q9NR12 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7RM8 Solution NMR structure of PDLIM7 PDZ bound to SNX17 peptide

Browse structure collections

About this viewer

MolViewer shows 2Q3G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.