7RM8: PDLIM7 PDZ

Solution NMR structure of PDLIM7 PDZ bound to SNX17 peptide. Determined by solution NMR. Released 31 Aug 2022.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 786
Mol. weight: 11.32 kDa
Released: 31 Aug 2022

Explore 7RM8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7RM8 contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	1
β-strand	16-21	6	1
α-helix	22-24	3
β-strand	26-33	8	1
α-helix	38-42	5
β-strand	49-53	5	1
β-strand	56-57	2	1
α-helix	63-71	9
β-strand	77-82	6	1
α-helix	94-97	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 4 of PDZ and LIM domain protein 7,Sorting nexin-17 fusion	A	protein	112	Homo sapiens	Q15036 (AlphaFold model), Q9NR12 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7RM8_1 Isoform 4 of PDZ and LIM domain protein 7,Sorting nexin-17 fusion (chains A)
GPMDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENA
GSLTHIEAQNKIRACGERLSLGLSRAGASAGASAGASAHGNFAFEGIGDEDL

Primary citation

Proteomic identification and structural basis for the interaction between sorting nexin SNX17 and PDLIM family proteins. Healy, M.D., Sacharz, J., McNally, K.E. et al. Structure (2022) 30:1590-1602.e6. DOI 10.1016/j.str.2022.10.001 · PubMed

Other PDB entries of the same protein (UniProt Q15036 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3LUI 1.8 Å, Crystal structure of the SNX17 PX domain with bound sulphate
4GXB 1.8 Å, Structure of the SNX17 atypical FERM domain bound to the NPxY motif of P-selectin
3FOG 2.8 Å, Crystal structure of the PX domain of sorting nexin-17 (SNX17)
4TKN 3.0 Å, Structure of the SNX17 FERM domain bound to the second NPxF motif of KRIT1
9AU7 3.4 Å, Human Retriever VPS35L/VPS29/VPS26C complex bound to SNX17 peptide (Composite Map)

Browse structure collections

About this viewer

MolViewer shows 7RM8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.