2Q4U: Protein Zgc:100843

Ensemble refinement of the crystal structure of an EF-hand protein from Danio rerio Dr.36843. Determined by X-ray diffraction at 2.1 Å resolution. Released 19 Jun 2007.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Danio rerio
Chains: 1
Atoms: 2,443
Mol. weight: 32.05 kDa
Released: 19 Jun 2007

Explore 2Q4U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Q4U contains 18 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
α-helix	10-20	11
β-strand	27-28	2	1
α-helix	30-32	3
α-helix	33-44	12
α-helix	52-61	10
α-helix	65-68	4
β-strand	74-75	2	1
α-helix	76-83	8
α-helix	86-97	12
α-helix	103-113	11
β-strand	120-122	3	2
α-helix	123-125	3
α-helix	126-136	11
α-helix	143-157	15
β-strand	164-166	3	2
α-helix	167-170	4
α-helix	171-173	3
α-helix	190-205	16
β-strand	212-214	3	3
α-helix	216-229	14
α-helix	239-248	10
β-strand	256-258	3	3
α-helix	259-265	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein Zgc:100843	A	protein	272	Danio rerio	Q5XJX1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2Q4U_1 Protein Zgc:100843 (chains A)
SDSAFANLDAAGFLQIWQHFDADDNGYIEGKELDDFFRHMLKKLQPKDKITDERVQQIKK
SFMSAYDATFDGRLQIEELANMILPQEENFLLIFRREAPLDNSVEFMKIWRKYDADSSGY
ISAAELKNFLKDLFLQHKKKIPPNKLDEYTDAMMKIFDKNKDGRLDLNDLARILALQENF
LLQFKMDASSQVERKRDFEKIFAHYDVSRTGALEGPEVDGFVKDMMELVRPSISGGDLDK
FRECLLTHCDMNKDGKIQKSELALCLGLKHKP

Primary citation

Ensemble refinement of protein crystal structures: validation and application. Levin, E.J., Kondrashov, D.A., Wesenberg, G.E. et al. Structure (2007) 15:1040-1052. DOI 10.1016/j.str.2007.06.019 · PubMed

Other PDB entries of the same protein (UniProt Q5XJX1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2BE4 2.1 Å, X-ray structure an ef-hand protein from danio rerio Dr.36843
6JLH 2.37 Å, Structure of SCGN in complex with a Snap25 peptide

Browse structure collections

About this viewer

MolViewer shows 2Q4U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.